Sinomonas cyclohexanicum: SCMU_22390 Help Entry SCMU_22390        CDS       T07918                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ccyc  Sinomonas cyclohexanicum Brite KEGG Orthology (KO) [BR:ccyc00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     SCMU_22390 Enzymes [BR:ccyc01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      SCMU_22390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  BCT76397 LinkDB All DBs Position 2319350..2319610 Genome browser AA seq 86 aa AA seqDB search MDNFTPADGTITMFSTTWCGYCNRLKKQLDAQGIGYTEVNIEEVAGTAELVEQLNGGNRT VPTVVFPDGTAATNPSAAQVKAKLGV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggacaacttcacccccgccgacggcacgatcacgatgttctcgaccacgtggtgcggg tactgcaatcgcctcaagaagcagctcgacgcacagggcatcggctacaccgaggtgaac atcgaggaggtcgcgggtacggcggagctcgtggagcagctcaatgggggcaaccggacg gtccccaccgtggtcttccccgacggcaccgccgcgacgaacccctccgcggcgcaggtg aaggctaagctcggggtctag

DBGET integrated database retrieval system