Sinomonas cyclohexanicum: SCMU_23610 Help Entry SCMU_23610        CDS       T07918                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccyc  Sinomonas cyclohexanicum Pathway ccyc01100   Metabolic pathways ccyc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccyc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SCMU_23610 (acpP)    00074 Mycolic acid biosynthesis     SCMU_23610 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SCMU_23610 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BCT76519 UniProt:  A0ABN6FIN3 LinkDB All DBs Position 2456938..2457183 Genome browser AA seq 81 aa AA seqDB search MATNEEILAGLAEIVNEETGLATDAVQLDKSFTDDLDIDSISMMTIVVNAEEKFGVRIPD EEVKNLTTVGDAVDFIAKAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcaacgaacgaagagatcctcgccggtctggccgagatcgtcaacgaggagacgggc ctcgccaccgacgcggtccagctcgacaagtccttcacggatgacctcgacatcgactcg atctcgatgatgaccatcgtggtcaacgccgaggagaagttcggcgtccgcatccccgac gaggaggtcaagaacctcacgacggttggcgacgcggtcgacttcatcgccaaggcccag gcctaa

DBGET integrated database retrieval system