KEGG   Corynebacterium cyclohexanicum: SCMU_29030
Entry
SCMU_29030        CDS       T07918                                 
Symbol
neuA
Name
(GenBank) acylneuraminate cytidylyltransferase
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
ccyc  Corynebacterium cyclohexanicum
Pathway
ccyc00541  O-Antigen nucleotide sugar biosynthesis
ccyc01100  Metabolic pathways
ccyc01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:ccyc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    SCMU_29030 (neuA)
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3
Other DBs
NCBI-ProteinID: BCT77061
LinkDB
Position
complement(3032342..3033064)
AA seq 240 aa
MNTLCVIPVRGGSKGIPRKNIRRVAGKPLVVWTIEQALAAKAGLDVLVSTDDSEIADVAR
AAGADVPFLRPAELAQDTTATEPVVRHAIDFRTSQGRRPDAVMLLQATSPLRFPGTLDRA
VEQFEATGVDSLVGVVPQTPFLWTMPLETGGQPAAQYTVGSRPRRQELAERDFRYRETGS
LYVTRTGIYEQLDNRLGGRIGLFVMDEREGVDVDTELDLAVAEQQLGRFREELEGETRAE
NT seq 723 nt   +upstreamnt  +downstreamnt
gtgaacaccctctgcgtcatccccgtccgcggcggatcgaagggcatcccgcggaagaac
atccgccgggtggccggcaagccgctcgtcgtgtggacgatcgagcaggccctcgccgcg
aaggccggcctcgacgtgctcgtctccaccgacgactccgagatcgcggacgtggcccgc
gcggccggcgccgacgtgccgttcctgcgccccgccgagctcgcccaggacaccaccgcg
accgagcccgtggtccgccacgccatcgacttccgcacctcccagggacgccgacccgac
gccgtcatgctcctccaggccacctcgccgctgcgcttccccggcacgctggaccgcgcc
gtggagcagttcgaggcgactggcgtcgactccctcgtgggtgtggtcccgcagaccccg
ttcctgtggaccatgccactcgagacggggggccagccggccgcccagtacactgtgggg
agcaggccgcgccgtcaggagctcgccgagcgggacttccggtaccgcgagaccgggtcc
ctctacgtgacgcggaccggcatctacgagcagctcgacaaccgcctcggcggccgcatc
ggcctgttcgtcatggacgagagggaaggcgtcgacgtcgacaccgagctggacctcgcc
gtcgccgaacagcagctaggccggttccgcgaggaactggagggggagacacgcgccgaa
tga

DBGET integrated database retrieval system