Chthonomonas calidirosea: CCALI_00237 Help Entry CCALI_00237       CDS       T02699                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccz  Chthonomonas calidirosea Pathway ccz01100   Metabolic pathways ccz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCALI_00237    00074 Mycolic acid biosynthesis     CCALI_00237   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCALI_00237 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Toxin_10 Motif Other DBs NCBI-ProteinID:  CCW34074 UniProt:  S0ESD6 LinkDB All DBs Position complement(261136..261378) Genome browser AA seq 80 aa AA seqDB search MSTTFDRVRKVLLDRLDVTEEEIVPEASLVNDLKADSLDVMEIVLRLEDEFTIDIPDEDA EKIVTVQDIVDYIDKKAAAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtctacaactttcgatcgtgtgcgtaaggtgctgcttgatagacttgatgtcactgaa gaggagatcgttcctgaagcctctctggtgaacgacctgaaagccgactctttagacgtg atggagattgtgcttcgtcttgaggacgagttcaccatagatatccccgacgaagatgcc gaaaagattgtcaccgttcaagacatcgtggactacatagacaaaaaggctgcagcctca tga

DBGET integrated database retrieval system