KEGG   Chthonomonas calidirosea: CCALI_00618
Entry
CCALI_00618       CDS       T02699                                 
Name
(GenBank) monosaccharide ABC transporter membrane protein,CUT2 family (TC 3.A.1.2.-)
  KO
K10440  ribose transport system permease protein
Organism
ccz  Chthonomonas calidirosea
Pathway
ccz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ccz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CCALI_00618
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccz02000]
    CCALI_00618
Transporters [BR:ccz02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    CCALI_00618
SSDB
Motif
Pfam: BPD_transp_2 GARP
Other DBs
NCBI-ProteinID: CCW34444
UniProt: S0ET03
LinkDB
Position
688720..689670
AA seq 316 aa
MGKLRSLPAETGVAFVFIFIVGFLSWRAPDFATWANIRLLTKQAAELMLVSLGMTFVIAT
GGIDLSVGSLLGLSGMVLGLVLLHGGTMITACLAALGVGLLVGALHGVLIGRARMPAILI
TLASYAAARAGATMIYNGGSISAIPLSMNELFDNTLFAGLPVLLWVSLIAIVFSWVLLRH
TSFGRSLLALGGNRRATYLTGVPTARIELLVYMLSGLCVGLAAIIDVALKATATPDAGQY
LELQAITAVVLGGTSITGGQATILGTALGVAVITVLLSGVRLMGMEDRVGWFFVGVALLL
AVEAQRGWRKKGDISS
NT seq 951 nt   +upstreamnt  +downstreamnt
atgggcaagctgcgctctcttccagcagaaaccggtgttgcctttgtcttcatctttatt
gtaggctttttgagttggagggcacctgacttcgcaacgtgggctaatatccgcctcctt
accaaacaggccgccgagctgatgttggtctctctagggatgacttttgtcatcgctacc
ggcggaattgacctgtctgtaggctccttacttggcctcagtgggatggtgctgggcctc
gtgctgcttcatggcggcacaatgattactgcgtgccttgccgcgttgggtgtaggcctg
ctcgttggagccttgcacggcgtgcttattgggcgagcccgcatgccagcgattcttatc
actttggcaagctacgccgccgcacgtgcgggagctaccatgatctacaatggtggaagc
atttcagcgattccgctctccatgaacgaacttttcgataacacgctctttgccggtttg
ccagttcttttgtgggtcagccttatcgccatcgttttcagttgggttcttctacgacac
acctcttttggccgcagtctccttgctctcggtggcaaccgtcgagctacctatctcacc
ggagtccctacagcgcgcatcgagcttttggtctatatgcttagcggcctatgcgttggt
ttggccgccatcattgatgtggcattaaaagccacagccacccctgatgccggccaatat
ctagaactacaggccatcacggccgtggtccttgggggcacctcgatcactggtggccaa
gccaccatacttgggacagcgcttggtgttgcggtcatcaccgtactgctcagcggcgtg
cgcctgatgggcatggaagatcgggtgggttggttttttgtcggcgtcgcgctgctgttg
gccgttgaggcccaaagaggatggagaaagaaaggagatatctcatcatga

DBGET integrated database retrieval system