Corynebacterium diphtheriae HC04: CDHC04_1590 Help Entry CDHC04_1590       CDS       T01696                                  Symbol acpM Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cda  Corynebacterium diphtheriae HC04 Pathway cda01100   Metabolic pathways cda01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cda00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDHC04_1590 (acpM)    00074 Mycolic acid biosynthesis     CDHC04_1590 (acpM)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDHC04_1590 (acpM) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C LisH_WDR26 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEX81581 LinkDB All DBs Position 1696225..1696416 Genome browser AA seq 63 aa AA seqDB search MLKRVGLDPEEMTPDTVLEDAGVDSLDRIEITVRLEQESGIELHDADVFPARTVHDLMQL IDQ NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtgctcaaacgcgtaggtcttgatcccgaggagatgactcccgataccgttttagaagat gctggggtcgattctttggatcgtattgagatcacagttcgccttgagcaagaaagcggc atcgagcttcacgacgccgacgtgtttccggctcgtacggtgcatgacttgatgcaattg attgatcaataa

DBGET integrated database retrieval system