Corynebacterium diphtheriae BH8: CDBH8_0478
Help
Entry
CDBH8_0478 CDS
T01698
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
cdb
Corynebacterium diphtheriae BH8
Pathway
cdb03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
cdb00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
CDBH8_0478 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
cdb03011
]
CDBH8_0478 (rplR)
Ribosome [BR:
cdb03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
CDBH8_0478 (rplR)
Bacteria
CDBH8_0478 (rplR)
Archaea
CDBH8_0478 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
AEX48003
LinkDB
All DBs
Position
473277..473684
Genome browser
AA seq
135 aa
AA seq
DB search
MSNTENNNAKRLPVGKDISTRRRIARARRHDRIRKNLRGTAETPRLVVHRSSRHMHVQVI
DDIAGRTLAAASTLEAEVRALEGDKKAKGAKVGQLIAERAQAAGITAIVFDRGGYKYHGR
IAALADAAREGGLKF
NT seq
408 nt
NT seq
+upstream
nt +downstream
nt
atgagcaacaccgaaaacaacaacgcaaagcgtcttccagtgggcaaggatatctccacc
cgccgtcgtatcgctcgcgcacgccgtcacgaccgtatccgcaagaacctgcgtggcacc
gccgagactccacgtctcgtcgtgcaccgctcttctcgccacatgcacgttcaggttatc
gacgacatcgctggtcgtaccctggctgctgcttccaccttggaagcagaagtacgcgca
cttgagggcgacaagaaggctaagggcgcaaaggtcggtcagctgatcgccgagcgcgca
caggctgctggcatcaccgctatcgtcttcgaccgcggtggctacaagtaccacggccgt
attgcagctttggctgatgcagctcgcgaaggcggtctgaagttctaa
DBGET
integrated database retrieval system