Clostridioides difficile CD196: CD196_0939 Help Entry CD196_0939        CDS       T00997                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cdc  Clostridioides difficile CD196 Pathway cdc01100   Metabolic pathways cdc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cdc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CD196_0939 (acpP)    00074 Mycolic acid biosynthesis     CD196_0939 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CD196_0939 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 PRD Motif Other DBs NCBI-ProteinID:  CBA61785 UniProt:  A0A0H3N0I2 LinkDB All DBs Position complement(1136348..1136575) Genome browser AA seq 75 aa AA seqDB search MFEKIKEIIAEQLGVDNLDEITMEASLMDDLEADSLDAVEIIMALEDEFGIEIPDEEAEN FKCIGDICKYIEENK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtttgagaaaataaaagaaataatagcagaacaattaggggtagacaatttagatgag ataactatggaagcatctttaatggacgacttagaagctgattcattagatgctgttgaa attataatggcccttgaagatgaatttggaatagaaataccagacgaggaagctgagaac tttaaatgtattggtgatatatgtaaatatatcgaagaaaacaaatag

DBGET integrated database retrieval system