Cryptococcus deuterogattii: CNBG_1531 Help Entry CNBG_1531         CDS       T09796                                  Name (RefSeq) replication factor A3   KO K10740   replication factor A3 Organism cdeu  Cryptococcus deuterogattii Pathway cdeu03030   DNA replication cdeu03420   Nucleotide excision repair cdeu03430   Mismatch repair cdeu03440   Homologous recombination cdeu03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cdeu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     CNBG_1531    03420 Nucleotide excision repair     CNBG_1531    03430 Mismatch repair     CNBG_1531    03440 Homologous recombination     CNBG_1531    03460 Fanconi anemia pathway     CNBG_1531  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cdeu03032]     CNBG_1531    03400 DNA repair and recombination proteins [BR:cdeu03400]     CNBG_1531 DNA replication proteins [BR:cdeu03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     CNBG_1531 DNA repair and recombination proteins [BR:cdeu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      CNBG_1531    MMR (mismatch excision repair)      CNBG_1531   DSBR (double strand breaks repair)    HR (homologous recombination)      CNBG_1531 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rep_fac-A_3 DUF5818 Motif Other DBs NCBI-GeneID:  88177946 NCBI-ProteinID:  XP_062881627 LinkDB All DBs Position 3:1284063..1284632 Genome browser AA seq 108 aa AA seqDB search MSRLGPEPRINSKHLSEHRGEIVRLIAKVATLSGDTATLETSDGGTIGIHLPRDMHIADQ YVEIIGTVKEDLTIRAHTHIGLGNNLDLRAVNSVIEFSHSPIGQGVLN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgtcttggtcctgagccgagaataaatagcaagcatctttcagaacaccgtggg gagattgttagactcattgccaaggtagcgacgttgtcaggggatacagcaacccttgag acaagcgatggtggtactatagggattcatctacctcgagacatgcacattgccgatcaa tacgttgagattatcgggacagtcaaagaagatttgacaatcagggcccatacgcatatc ggtttaggcaataacttagatttgagagcggtcaacagtgtcatcgagttttcacattca cctatcgggcaaggtgtcctcaattag

DBGET integrated database retrieval system