Cryptococcus deuterogattii: CNBG_9686 Help Entry CNBG_9686         CDS       T09796                                  Name (RefSeq) uncharacterized protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism cdeu  Cryptococcus deuterogattii Pathway cdeu03020   RNA polymerase cdeu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cdeu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CNBG_9686   09124 Replication and repair    03420 Nucleotide excision repair     CNBG_9686  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cdeu03021]     CNBG_9686    03400 DNA repair and recombination proteins [BR:cdeu03400]     CNBG_9686 Transcription machinery [BR:cdeu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CNBG_9686   RNA polymerase III system    RNA polymerase III      CNBG_9686   RNA polymerase I system    RNA polymerase I      CNBG_9686 DNA repair and recombination proteins [BR:cdeu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CNBG_9686 SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPAB4 Zn_ribbon_TFIIS Zn_Ribbon_TF DUF5816 zf_C2H2_LIN26-LIR3 Zn_ribbon_DZR_6 DUF7129 Zn_ribbon_recom Zn_ribbon_NUD DZR HypA Zn_ribbon_8 DmmA-like_C Zn_ribbon_10 Zf_2nd_IFT121 DUF951 DUF8096 Zn_ribbon_13 Motif Other DBs NCBI-GeneID:  88182901 NCBI-ProteinID:  XP_062886456 LinkDB All DBs Position 2:complement(<1678059..>1678531) Genome browser AA seq 70 aa AA seqDB search MSQPQSRYTQQNPNPMPDRNVKAPETISYICGDCGAQTAMQPSEFIRCKECGHRVMYKPR TTRIVQFEAR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtcccagcctcaatctcgatacacacagcaaaatcctaatcccatgcctgatcgaaac gtcaaggcccccgagaccatctcttacatatgtggtgattgtggggcgcagactgctatg caaccttcagagtttattagatgcaaggaatgcggccaccgagttatgtacaagcctcga acaacgaggatcgtgcaatttgaggctcgatga

DBGET integrated database retrieval system