KEGG   Clostridioides difficile 630: CD630_06630
Entry
CD630_06630       CDS       T00487                                 

Symbol
tcdA
Name
(GenBank) Toxin A
  KO
K11063  toxin A/B
Organism
cdf  Clostridioides difficile 630
Pathway
cdf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CD630_06630 (tcdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cdf02042]
    CD630_06630 (tcdA)
Bacterial toxins [BR:cdf02042]
 Type III toxins: Intracellular toxins
  Others
   Toxin A/B
    CD630_06630 (tcdA)
SSDB
Motif
Pfam: TcdA_TcdB_pore TcdA_TcdB Choline_bind_3 Peptidase_C80 Choline_bind_1 TcdB_N MLD Gly_transf_sug RING_CBP-p300
Other DBs
NCBI-ProteinID: CAJ67494
UniProt: Q189K5
LinkDB
Structure
PDB: 

Position
795843..803975
AA seq 2710 aa
MSLISKEELIKLAYSIRPRENEYKTILTNLDEYNKLTTNNNENKYLQLKKLNESIDVFMN
KYKTSSRNRALSNLKKDILKEVILIKNSNTSPVEKNLHFVWIGGEVSDIALEYIKQWADI
NAEYNIKLWYDSEAFLVNTLKKAIVESSTTEALQLLEEEIQNPQFDNMKFYKKRMEFIYD
RQKRFINYYKSQINKPTVPTIDDIIKSHLVSEYNRDETVLESYRTNSLRKINSNHGIDIR
ANSLFTEQELLNIYSQELLNRGNLAAASDIVRLLALKNFGGVYLDVDMLPGIHSDLFKTI
SRPSSIGLDRWEMIKLEAIMKYKKYINNYTSENFDKLDQQLKDNFKLIIESKSEKSEIFS
KLENLNVSDLEIKIAFALGSVINQALISKQGSYLTNLVIEQVKNRYQFLNQHLNPAIESD
NNFTDTTKIFHDSLFNSATAENSMFLTKIAPYLQVGFMPEARSTISLSGPGAYASAYYDF
INLQENTIEKTLKASDLIEFKFPENNLSQLTEQEINSLWSFDQASAKYQFEKYVRDYTGG
SLSEDNGVDFNKNTALDKNYLLNNKIPSNNVEEAGSKNYVHYIIQLQGDDISYEATCNLF
SKNPKNSIIIQRNMNESAKSYFLSDDGESILELNKYRIPERLKNKEKVKVTFIGHGKDEF
NTSEFARLSVDSLSNEISSFLDTIKLDISPKNVEVNLLGCNMFSYDFNVEETYPGKLLLS
IMDKITSTLPDVNKNSITIGANQYEVRINSEGRKELLAHSGKWINKEEAIMSDLSSKEYI
FFDSIDNKLKAKSKNIPGLASISEDIKTLLLDASVSPDTKFILNNLKLNIESSIGDYIYY
EKLEPVKNIIHNSIDDLIDEFNLLENVSDELYELKKLNNLDEKYLISFEDISKNNSTYSV
RFINKSNGESVYVETEKEIFSKYSEHITKEISTIKNSIITDVNGNLLDNIQLDHTSQVNT
LNAAFFIQSLIDYSSNKDVLNDLSTSVKVQLYAQLFSTGLNTIYDSIQLVNLISNAVNDT
INVLPTITEGIPIVSTILDGINLGAAIKELLDEHDPLLKKELEAKVGVLAINMSLSIAAT
VASIVGIGAEVTIFLLPIAGISAGIPSLVNNELILHDKATSVVNYFNHLSESKKYGPLKT
EDDKILVPIDDLVISEIDFNNNSIKLGTCNILAMEGGSGHTVTGNIDHFFSSPSISSHIP
SLSIYSAIGIETENLDFSKKIMMLPNAPSRVFWWETGAVPGLRSLENDGTRLLDSIRDLY
PGKFYWRFYAFFDYAITTLKPVYEDTNIKIKLDKDTRNFIMPTITTNEIRNKLSYSFDGA
GGTYSLLLSSYPISTNINLSKDDLWIFNIDNEVREISIENGTIKKGKLIKDVLSKIDINK
NKLIIGNQTIDFSGDIDNKDRYIFLTCELDDKISLIIEINLVAKSYSLLLSGDKNYLISN
LSNIIEKINTLGLDSKNIAYNYTDESNNKYFGAISKTSQKSIIHYKKDSKNILEFYNDST
LEFNSKDFIAEDINVFMKDDINTITGKYYVDNNTDKSIDFSISLVSKNQVKVNGLYLNES
VYSSYLDFVKNSDGHHNTSNFMNLFLDNISFWKLFGFENINFVIDKYFTLVGKTNLGYVE
FICDNNKNIDIYFGEWKTSSSKSTIFSGNGRNVVVEPIYNPDTGEDISTSLDFSYEPLYG
IDRYINKVLIAPDLYTSLININTNYYSNEYYPEIIVLNPNTFHKKVNINLDSSSFEYKWS
TEGSDFILVRYLEESNKKILQKIRIKGILSNTQSFNKMSIDFKDIKKLSLGYIMSNFKSF
NSENELDRDHLGFKIIDNKTYYYDEDSKLVKGLININNSLFYFDPIEFNLVTGWQTINGK
KYYFDINTGAALISYKIINGKHFYFNNDGVMQLGVFKGPDGFEYFAPANTQNNNIEGQAI
VYQSKFLTLNGKKYYFDNDSKAVTGWRIINNEKYYFNPNNAIAAVGLQVIDNNKYYFNPD
TAIISKGWQTVNGSRYYFDTDTAIAFNGYKTIDGKHFYFDSDCVVKIGVFSTSNGFEYFA
PANTYNNNIEGQAIVYQSKFLTLNGKKYYFDNNSKAVTGWQTIDSKKYYFNTNTAEAATG
WQTIDGKKYYFNTNTAEAATGWQTIDGKKYYFNTNTAIASTGYTIINGKHFYFNTDGIMQ
IGVFKGPNGFEYFAPANTDANNIEGQAILYQNEFLTLNGKKYYFGSDSKAVTGWRIINNK
KYYFNPNNAIAAIHLCTINNDKYYFSYDGILQNGYITIERNNFYFDANNESKMVTGVFKG
PNGFEYFAPANTHNNNIEGQAIVYQNKFLTLNGKKYYFDNDSKAVTGWQTIDGKKYYFNL
NTAEAATGWQTIDGKKYYFNLNTAEAATGWQTIDGKKYYFNTNTFIASTGYTSINGKHFY
FNTDGIMQIGVFKGPNGFEYFAPANTHNNNIEGQAILYQNKFLTLNGKKYYFGSDSKAVT
GLRTIDGKKYYFNTNTAVAVTGWQTINGKKYYFNTNTSIASTGYTIISGKHFYFNTDGIM
QIGVFKGPDGFEYFAPANTDANNIEGQAIRYQNRFLYLHDNIYYFGNNSKAATGWVTIDG
NRYYFEPNTAMGANGYKTIDNKNFYFRNGLPQIGVFKGSNGFEYFAPANTDANNIEGQAI
RYQNRFLHLLGKIYYFGNNSKAVTGWQTINGKVYYFMPDTAMAAAGGLFEIDGVIYFFGV
DGVKAPGIYG
NT seq 8133 nt   +upstreamnt  +downstreamnt
atgtctttaatatctaaagaagagttaataaaactcgcatatagcattagaccaagagaa
aatgagtataaaactatactaactaatttagacgaatataataagttaactacaaacaat
aatgaaaataaatatttacaattaaaaaaactaaatgaatcaattgatgtttttatgaat
aaatataaaacttcaagcagaaatagagcactctctaatctaaaaaaagatatattaaaa
gaagtaattcttattaaaaattccaatacaagccctgtagaaaaaaatttacattttgta
tggataggtggagaagtcagtgatattgctcttgaatacataaaacaatgggctgatatt
aatgcagaatataatattaaactgtggtatgatagtgaagcattcttagtaaatacacta
aaaaaggctatagttgaatcttctaccactgaagcattacagctactagaggaagagatt
caaaatcctcaatttgataatatgaaattttacaaaaaaaggatggaatttatatatgat
agacaaaaaaggtttataaattattataaatctcaaatcaataaacctacagtacctaca
atagatgatattataaagtctcatctagtatctgaatataatagagatgaaactgtatta
gaatcatatagaacaaattctttgagaaaaataaatagtaatcatgggatagatatcagg
gctaatagtttgtttacagaacaagagttattaaatatttatagtcaggagttgttaaat
cgtggaaatttagctgcagcatctgacatagtaagattattagccctaaaaaattttggc
ggagtatatttagatgttgatatgcttccaggtattcactctgatttatttaaaacaata
tctagacctagctctattggactagaccgttgggaaatgataaaattagaggctattatg
aagtataaaaaatatataaataattatacatcagaaaactttgataaacttgatcaacaa
ttaaaagataattttaaactcattatagaaagtaaaagtgaaaaatctgagatattttct
aaattagaaaatttaaatgtatctgatcttgaaattaaaatagctttcgctttaggcagt
gttataaatcaagccttgatatcaaaacaaggttcatatcttactaacctagtaatagaa
caagtaaaaaatagatatcaatttttaaaccaacaccttaacccagccatagagtctgat
aataacttcacagatactactaaaatttttcatgattcattatttaattcagctaccgca
gaaaactctatgtttttaacaaaaatagcaccatacttacaagtaggttttatgccagaa
gctcgctccacaataagtttaagtggtccaggagcttatgcgtcagcttactatgatttc
ataaatttacaagaaaatactatagaaaaaactttaaaagcatcagatttaatagaattt
aaattcccagaaaataatctatctcaattgacagaacaagaaataaatagtctatggagc
tttgatcaagcaagtgcaaaatatcaatttgagaaatatgtaagagattatactggtgga
tctctttctgaagacaatggggtagactttaataaaaatactgccctcgacaaaaactat
ttattaaataataaaattccatcaaacaatgtagaagaagctggaagtaaaaattatgtt
cattatatcatacagttacaaggagatgatataagttatgaagcaacatgcaatttattt
tctaaaaatcctaaaaatagtattattatacaacgaaatatgaatgaaagtgcaaaaagc
tactttttaagtgatgatggagaatctattttagaattaaataaatataggatacctgaa
agattaaaaaataaggaaaaagtaaaagtaacctttattggacatggtaaagatgaattc
aacacaagcgaatttgctagattaagtgtagattcactttccaatgagataagttcattt
ttagataccataaaattagatatatcacctaaaaatgtagaagtaaacttacttggatgt
aatatgtttagttatgattttaatgttgaagaaacttatcctgggaagttgctattaagt
attatggacaaaattacttccactttacctgatgtaaataaaaattctattactatagga
gcaaatcaatatgaagtaagaattaatagtgagggaagaaaagaacttctggctcactca
ggtaaatggataaataaagaagaagctattatgagcgatttatctagtaaagaatacatt
ttttttgattctatagataataagctaaaagcaaagtccaagaatattccaggattagca
tcaatatcagaagatataaaaacattattacttgatgcaagtgttagtcctgatacaaaa
tttattttaaataatcttaagcttaatattgaatcttctattggtgattacatttattat
gaaaaattagagcctgttaaaaatataattcacaattctatagatgatttaatagatgag
ttcaatctacttgaaaatgtatctgatgaattatatgaattaaaaaaattaaataatcta
gatgagaagtatttaatatcttttgaagatatctcaaaaaataattcaacttactctgta
agatttattaacaaaagtaatggtgagtcagtttatgtagaaacagaaaaagaaattttt
tcaaaatatagcgaacatattacaaaagaaataagtactataaagaatagtataattaca
gatgttaatggtaatttattggataatatacagttagatcatacttctcaagttaataca
ttaaacgcagcattctttattcaatcattaatagattatagtagcaataaagatgtactg
aatgatttaagtacctcagttaaggttcaactttatgctcaactatttagtacaggttta
aatactatatatgactctatccaattagtaaatttaatatcaaatgcagtaaatgatact
ataaatgtactacctacaataacagaggggatacctattgtatctactatattagacgga
ataaacttaggtgcagcaattaaggaattactagacgaacatgacccattactaaaaaaa
gaattagaagctaaggtgggtgttttagcaataaatatgtcattatctatagctgcaact
gtagcttcaattgttggaataggtgctgaagttactattttcttattacctatagctggt
atatctgcaggaataccttcattagttaataatgaattaatattgcatgataaggcaact
tcagtggtaaactattttaatcatttgtctgaatctaaaaaatatggccctcttaaaaca
gaagatgataaaattttagttcctattgatgatttagtaatatcagaaatagattttaat
aataattcgataaaactaggaacatgtaatatattagcaatggaggggggatcaggacac
acagtgactggtaatatagatcactttttctcatctccatctataagttctcatattcct
tcattatcaatttattctgcaataggtatagaaacagaaaatctagatttttcaaaaaaa
ataatgatgttacctaatgctccttcaagagtgttttggtgggaaactggagcagttcca
ggtttaagatcattggaaaatgacggaactagattacttgattcaataagagatttatac
ccaggtaaattttactggagattctatgcttttttcgattatgcaataactacattaaaa
ccagtttatgaagacactaatattaaaattaaactagataaagatactagaaacttcata
atgccaactataactactaacgaaattagaaacaaattatcttattcatttgatggagca
ggaggaacttactctttattattatcttcatatccaatatcaacgaatataaatttatct
aaagatgatttatggatatttaatattgataatgaagtaagagaaatatctatagaaaat
ggtactattaaaaaaggaaagttaataaaagatgttttaagtaaaattgatataaataaa
aataaacttattataggcaatcaaacaatagatttttcaggcgatatagataataaagat
agatatatattcttgacttgtgagttagatgataaaattagtttaataatagaaataaat
cttgttgcaaaatcttatagtttgttattgtctggggataaaaattatttgatatccaat
ttatctaatattattgagaaaatcaatactttaggcctagatagtaaaaatatagcgtac
aattacactgatgaatctaataataaatattttggagctatatctaaaacaagtcaaaaa
agcataatacattataaaaaagacagtaaaaatatattagaattttataatgacagtaca
ttagaatttaacagtaaagattttattgctgaagatataaatgtatttatgaaagatgat
attaatactataacaggaaaatactatgttgataataatactgataaaagtatagatttc
tctatttctttagttagtaaaaatcaagtaaaagtaaatggattatatttaaatgaatcc
gtatactcatcttaccttgattttgtgaaaaattcagatggacaccataatacttctaat
tttatgaatttatttttggacaatataagtttctggaaattgtttgggtttgaaaatata
aattttgtaatcgataaatactttacccttgttggtaaaactaatcttggatatgtagaa
tttatttgtgacaataataaaaatatagatatatattttggtgaatggaaaacatcgtca
tctaaaagcactatatttagcggaaatggtagaaatgttgtagtagagcctatatataat
cctgatacgggtgaagatatatctacttcactagatttttcctatgaacctctctatgga
atagatagatatatcaataaagtattgatagcacctgatttatatacaagtttaataaat
attaataccaattattattcaaatgagtactaccctgagattatagttcttaacccaaat
acattccacaaaaaagtaaatataaatttagatagttcttcttttgagtataaatggtct
acagaaggaagtgactttattttagttagatacttagaagaaagtaataaaaaaatatta
caaaaaataagaatcaaaggtatcttatctaatactcaatcatttaataaaatgagtata
gattttaaagatattaaaaaactatcattaggatatataatgagtaattttaaatcattt
aattctgaaaatgaattagatagagatcatttaggatttaaaataatagataataaaact
tattactatgatgaagatagtaaattagttaaaggattaatcaatataaataattcatta
ttctattttgatcctatagaatttaacttagtaactggatggcaaactatcaatggtaaa
aaatattattttgatataaatactggagcagctttaattagttataaaattattaatggt
aaacacttttattttaataatgatggtgtgatgcagttgggagtatttaaaggacctgat
ggatttgaatattttgcacctgccaatactcaaaataataacatagaaggtcaggctata
gtttatcaaagtaaattcttaactttgaatggcaaaaaatattattttgataatgactca
aaagcagtcactggatggagaattattaacaatgagaaatattactttaatcctaataat
gctattgctgcagtcggattgcaagtaattgacaataataagtattatttcaatcctgac
actgctatcatctcaaaaggttggcagactgttaatggtagtagatactactttgatact
gataccgctattgcctttaatggttataaaactattgatggtaaacacttttattttgat
agtgattgtgtagtgaaaataggtgtgtttagtacctctaatggatttgaatattttgca
cctgctaatacttataataataacatagaaggtcaggctatagtttatcaaagtaaattc
ttaactttgaatggtaaaaaatattactttgataataactcaaaagcagttaccggatgg
caaactattgatagtaaaaaatattactttaatactaacactgctgaagcagctactgga
tggcaaactattgatggtaaaaaatattactttaatactaacactgctgaagcagctact
ggatggcaaactattgatggtaaaaaatattactttaatactaacactgctatagcttca
actggttatacaattattaatggtaaacatttttattttaatactgatggtattatgcag
ataggagtgtttaaaggacctaatggatttgaatattttgcacctgctaatacggatgct
aacaacatagaaggtcaagctatactttaccaaaatgaattcttaactttgaatggtaaa
aaatattactttggtagtgactcaaaagcagttactggatggagaattattaacaataag
aaatattactttaatcctaataatgctattgctgcaattcatctatgcactataaataat
gacaagtattactttagttatgatggaattcttcaaaatggatatattactattgaaaga
aataatttctattttgatgctaataatgaatctaaaatggtaacaggagtatttaaagga
cctaatggatttgagtattttgcacctgctaatactcacaataataacatagaaggtcag
gctatagtttaccagaacaaattcttaactttgaatggcaaaaaatattattttgataat
gactcaaaagcagttactggatggcaaaccattgatggtaaaaaatattactttaatctt
aacactgctgaagcagctactggatggcaaactattgatggtaaaaaatattactttaat
cttaacactgctgaagcagctactggatggcaaactattgatggtaaaaaatattacttt
aatactaacactttcatagcctcaactggttatacaagtattaatggtaaacatttttat
tttaatactgatggtattatgcagataggagtgtttaaaggacctaatggatttgaatac
tttgcacctgctaatactcataataataacatagaaggtcaagctatactttaccaaaat
aaattcttaactttgaatggtaaaaaatattactttggtagtgactcaaaagcagttacc
ggattgcgaactattgatggtaaaaaatattactttaatactaacactgctgttgcagtt
actggatggcaaactattaatggtaaaaaatactactttaatactaacacttctatagct
tcaactggttatacaattattagtggtaaacatttttattttaatactgatggtattatg
cagataggagtgtttaaaggacctgatggatttgaatactttgcacctgctaatacagat
gctaacaatatagaaggtcaagctatacgttatcaaaatagattcctatatttacatgac
aatatatattattttggtaataattcaaaagcagctactggttgggtaactattgatggt
aatagatattacttcgagcctaatacagctatgggtgcgaatggttataaaactattgat
aataaaaatttttactttagaaatggtttacctcagataggagtgtttaaagggtctaat
ggatttgaatactttgcacctgctaatacggatgctaacaatatagaaggtcaagctata
cgttatcaaaatagattcctacatttacttggaaaaatatattactttggtaataattca
aaagcagttactggatggcaaactattaatggtaaagtatattactttatgcctgatact
gctatggctgcagctggtggacttttcgagattgatggtgttatatatttctttggtgtt
gatggagtaaaagcccctgggatatatggctaa

DBGET integrated database retrieval system