Corynebacterium diphtheriae INCA 402: CDB402_1345 Help Entry CDB402_1345       CDS       T01688                                  Symbol ptsH Name (GenBank) phosphocarrier protein Hpr   KO K02784   phosphocarrier protein HPr Organism cdh  Corynebacterium diphtheriae INCA 402 Pathway cdh02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:cdh00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     CDB402_1345 (ptsH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cdh02000]     CDB402_1345 (ptsH) Transporters [BR:cdh02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     CDB402_1345 (ptsH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Cwp8_D3 Motif Other DBs NCBI-ProteinID:  AEX46644 LinkDB All DBs Position 1463552..1463818 Genome browser AA seq 88 aa AA seqDB search MASKTVSVGSSVGLHARPASIIAEAAGEFDEDIFLTIEGEDDDETDAASSLMIMALGAEK GDKVTVTSENPEAVEKIAALIEKDLDAV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcttccaagaccgtttctgtcggatcctccgtcggcctgcatgcacgcccagcgtcg attattgcagaggcagccggtgaatttgatgaggatatcttcctcaccatcgaaggcgaa gacgatgatgagactgatgcagcttcgtctcttatgatcatggctttgggtgcagagaag ggcgataaggttaccgtcacctccgaaaaccctgaggctgttgagaagatcgcagctttg atcgaaaaggatctcgacgccgtttaa

DBGET integrated database retrieval system