KEGG   Corynebacterium diphtheriae INCA 402: CDB402_1442
Entry
CDB402_1442       CDS       T01688                                 
Symbol
rnc
Name
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CDB402_1442 (rnc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cdh03019]
    CDB402_1442 (rnc)
   03009 Ribosome biogenesis [BR:cdh03009]
    CDB402_1442 (rnc)
   03036 Chromosome and associated proteins [BR:cdh03036]
    CDB402_1442 (rnc)
Enzymes [BR:cdh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     CDB402_1442 (rnc)
Messenger RNA biogenesis [BR:cdh03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     CDB402_1442 (rnc)
Ribosome biogenesis [BR:cdh03009]
 Eukaryotic type
  90S particles
   RNase
    CDB402_1442 (rnc)
 Prokaryotic type
  rRNA processing factors
   CDB402_1442 (rnc)
Chromosome and associated proteins [BR:cdh03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     CDB402_1442 (rnc)
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm DSRM_2 RM44_endonuclase Neugrin PaaA_PaaC Dicer_dsRBD DND1_DSRM Cep192_D5
Other DBs
NCBI-ProteinID: AEX46741
LinkDB
Position
complement(1571654..1572403)
AA seq 249 aa
MSRRKKRVTGEQALRLEFESVDHQPLIDALGVDIPRELLVLALTHRSFANENGMLPNNER
LEFLGDSVLGLSVAGQLYQQYTSSPESDISKMRASIVSRYGLADIAREINLGQHILLGKG
EQLHDGRSKDSILADTTEALLGAIYLAHGFEIARDTVLRLFKHKIDTASATGLHQDWKTT
LQERLAERNLEMPTYTSTVTGPEHEQTFTAEVAVHGTVLGTGVGTNKKLAEQAAAHKAVG
FLQDNPAFV
NT seq 750 nt   +upstreamnt  +downstreamnt
gtgagcaggagaaaaaaacgcgtcactggtgagcaggcgctacgacttgaattcgagagc
gttgatcaccaaccactgattgatgcgttgggggttgacatcccacgtgagctactcgtg
ctggcgttaacacaccgttcgtttgcaaacgaaaatggcatgctgcccaacaatgagcgc
ctagaatttctaggcgattccgtcttaggactttctgtcgcagggcagttgtatcagcag
tacacgtcgagccctgaaagcgatatttccaagatgcgcgcgagtatcgtgagccgttat
gggcttgcagacattgctcgcgaaattaacctagggcagcacattttgctgggtaaaggt
gaacagcttcacgacggtcgcagcaaagactcaattctcgcagatacgacggaggcgctt
ctcggcgctatctacctagcgcatggttttgaaattgctcgtgacacggtgcttcgtttg
ttcaagcacaaaattgatacggcaagtgctacgggtcttcaccaagactggaaaaccacc
ttgcaagagcgtttggcagagcgcaaccttgagatgccaacatatacttctactgttaca
ggtccagagcatgagcaaactttcacagcagaggttgcagttcatggcactgtgctagga
actggtgttggaacaaacaaaaaacttgcggagcaagctgcagcccacaaagcggttggc
ttccttcaagataatcccgcgtttgtctaa

DBGET integrated database retrieval system