Corynebacterium diphtheriae NCTC 13129: DIP2290
Help
Entry
DIP2290 CDS
T00151
Symbol
ssb1
Name
(GenBank) single-strand DNA binding protein
KO
K03111
single-strand DNA-binding protein
Organism
cdi
Corynebacterium diphtheriae NCTC 13129
Pathway
cdi03030
DNA replication
cdi03430
Mismatch repair
cdi03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
cdi00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
DIP2290 (ssb1)
03430 Mismatch repair
DIP2290 (ssb1)
03440 Homologous recombination
DIP2290 (ssb1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
cdi03032
]
DIP2290 (ssb1)
03400 DNA repair and recombination proteins [BR:
cdi03400
]
DIP2290 (ssb1)
03029 Mitochondrial biogenesis [BR:
cdi03029
]
DIP2290 (ssb1)
DNA replication proteins [BR:
cdi03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
DIP2290 (ssb1)
DNA repair and recombination proteins [BR:
cdi03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
DIP2290 (ssb1)
TLS (translesion DNA synthesis) factors
Other SOS response factors
DIP2290 (ssb1)
Mitochondrial biogenesis [BR:
cdi03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
DIP2290 (ssb1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
tRNA_anti-codon
tRNA_anti_2
SSB_1
Ribosomal_S3_C
Motif
Other DBs
NCBI-ProteinID:
CAE50813
UniProt:
A0A0D6H9D3
Q6NEI4
LinkDB
All DBs
Position
complement(2387462..2388043)
Genome browser
AA seq
193 aa
AA seq
DB search
MAQGDVNITVVGNLVADPELRFTPSGAAVANFRIASTPRRYDSQTNQWVDGEALFLQCNI
WRQAAENVAESLTKGMRVIVTGRLRQRSYETREGEKRSVMELEVDEVGPSLRYAAASVNR
NPREGGNGGGNFGGSQGGFGGNTGGNSGGGFGAPQGGFGGGPQNSQSAAPANDPWSSAPQ
AGGFGGAEQDPPF
NT seq
582 nt
NT seq
+upstream
nt +downstream
nt
atggcacaaggagatgtcaacataaccgttgtcggcaacctcgttgctgacccggagctt
cgcttcacccctagcggtgcagcggtggcaaacttccgcattgcctccaccccacgtcgt
tacgactctcaaacgaaccagtgggtagacggcgaagccttgttcctgcagtgcaacatt
tggcgccaagctgccgaaaacgtcgcagaatccctgaccaagggcatgcgcgtgatcgtc
actggccgtttgcgtcaacgctcctacgaaacccgtgagggcgaaaagcgcagcgtcatg
gagcttgaggtcgacgaagtcggcccatccctacgctacgcagcagcaagcgtgaaccgt
aaccctcgcgagggtggaaacggcggaggaaacttcggcggctcccagggtggtttcggc
ggaaacaccggaggcaactcaggtggcggattcggcgctcctcaaggtggcttcggaggc
ggcccgcagaactcccagagtgctgcaccagccaacgatccatggagcagtgccccgcaa
gcaggtggattcggcggtgcggagcaagatccaccgttctaa
DBGET
integrated database retrieval system