Camelus dromedarius (Arabian camel): 105085320 Help Entry 105085320         CDS       T04642                                  Symbol CAV1 Name (RefSeq) caveolin-1 isoform X3   KO K06278   caveolin 1 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04144   Endocytosis cdk04510   Focal adhesion cdk05020   Prion disease cdk05100   Bacterial invasion of epithelial cells cdk05205   Proteoglycans in cancer cdk05416   Viral myocarditis cdk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105085320 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105085320 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105085320 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105085320 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     105085320 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105085320 (CAV1)    05416 Viral myocarditis     105085320 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cdk04131]     105085320 (CAV1) Membrane trafficking [BR:cdk04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     105085320 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  105085320 NCBI-ProteinID:  XP_010973871 LinkDB All DBs Position 7:55829382..55862131 Genome browser AA seq 148 aa AA seqDB search MADEMNEEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFT TFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTFCDPLFEAIGKIFSNIRINMQKEI NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagacgagatgaacgaggagaagcaagtgtacgacgcgcacaccaaggagattgac ctggtcaaccgcgaccccaagcatctcaacgacgacgtggtcaagattgattttgaagat gtgattgcggaaccagaagggacacacagttttgatggcatctggaaggccagcttcacc accttcactgtgacgaagtactggttttaccgtttgctgtctgccctctttggcatccca atggcactcatctggggcatttacttcgccattctctctttcttgcacatctgggcggtt gtaccgtgcattaagagtttcctgattgagattcagtgcatcagccgtgtctattccatc tacgtccacaccttctgtgacccactctttgaggctatcggcaaaatattcagcaatatc cgcatcaacatgcagaaagaaatataa

DBGET integrated database retrieval system