Camelus dromedarius (Arabian camel): 105085652 Help Entry 105085652         CDS       T04642                                  Name (RefSeq) glutathione S-transferase Mu 1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk00480   Glutathione metabolism cdk00980   Metabolism of xenobiotics by cytochrome P450 cdk00982   Drug metabolism - cytochrome P450 cdk00983   Drug metabolism - other enzymes cdk01100   Metabolic pathways cdk01524   Platinum drug resistance cdk05200   Pathways in cancer cdk05204   Chemical carcinogenesis - DNA adducts cdk05207   Chemical carcinogenesis - receptor activation cdk05208   Chemical carcinogenesis - reactive oxygen species cdk05225   Hepatocellular carcinoma cdk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     105085652   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     105085652    00982 Drug metabolism - cytochrome P450     105085652    00983 Drug metabolism - other enzymes     105085652  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105085652    05204 Chemical carcinogenesis - DNA adducts     105085652    05207 Chemical carcinogenesis - receptor activation     105085652    05208 Chemical carcinogenesis - reactive oxygen species     105085652   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105085652   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105085652   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105085652  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cdk02000]     105085652 Enzymes [BR:cdk01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      105085652 Transporters [BR:cdk02000]  Other transporters   Pores ion channels [TC:1]    105085652 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_N GST_C GST_C_3 GST_N_2 GST_N_3 GST_C_6 GST_C_2 Motif Other DBs NCBI-GeneID:  105085652 NCBI-ProteinID:  XP_010974221 UniProt:  G9B5E4 Structure PDBPDBj LinkDB All DBs Position 9:14861331..14867113 Genome browser AA seq 218 aa AA seqDB search MPMILGYWDIRGLAHAIRLLLEYTGSDYEEKIYSMGDAPDYDRSQWLSEKFKLGLDFPNL PYLIDGAHRLTQSNAILRYIARKHNLCGETEEEKIRVDVLENQAMDTRLDFARVCYNPDF EKLKPGFLKEIPEKMKLFSEFLGKRTWFAGDKLNYVDFLAYDVLDVYRIFEPKCLDEFPN LKDFMSRFEGLKKISAYMKSSRFLRSPLFLKMAMWGNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgcctatgatcctgggttactgggacatccgcgggctggctcacgccatccgcctgctc ttggagtacacaggctcagactatgaggagaagatttactcgatgggggacgctcctgac tatgatagaagccagtggctgagtgaaaaattcaagctgggcctggacttccccaatctg ccctacctaattgatggggctcacaggctcacccagagcaacgccatccttcgctacatt gctcgcaagcacaacctgtgtggggagacagaggaggagaagattcgagtggacgttttg gagaaccaggctatggacacgcgcttggatttcgccagagtctgctacaaccctgacttt gagaagcttaagccaggtttcttgaaagagatccctgaaaagatgaagctcttctcagag tttctggggaagaggacttggtttgcaggagacaagctcaactatgtggatttcttggct tatgatgtccttgacgtgtaccgcatatttgagcccaagtgcctggatgaattcccaaac ctgaaagacttcatgagccgctttgagggcctgaagaagatttctgcctacatgaagtcc agccgcttcctccgaagccctctgtttctaaagatggccatgtggggcaacaagtag

DBGET integrated database retrieval system