Camelus dromedarius (Arabian camel): 105088258 Help Entry 105088258         CDS       T04642                                  Symbol CCL11 Name (RefSeq) eotaxin   KO K16597   C-C motif chemokine 11 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04062   Chemokine signaling pathway cdk04657   IL-17 signaling pathway cdk05310   Asthma Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105088258 (CCL11)    04061 Viral protein interaction with cytokine and cytokine receptor     105088258 (CCL11)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     105088258 (CCL11)    04062 Chemokine signaling pathway     105088258 (CCL11)  09160 Human Diseases   09163 Immune disease    05310 Asthma     105088258 (CCL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105088258 (CCL11) Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Chemokines    105088258 (CCL11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  105088258 NCBI-ProteinID:  XP_010977361 UniProt:  A0A5N4D3W0 LinkDB All DBs Position 16:complement(30041301..30043664) Genome browser AA seq 102 aa AA seqDB search MKVSMVLLCLLLTAMVFSTQVLALPASIPTICCFTMAKRKISIQRLQSYRRITGSKCPQK AVIFSTKQAKKICADPQKKWVQEAMKYLDQKSQTLKPQILTF NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctcgatggtgctcctgtgcctcctgctcacagcaatggtcttcagcacccag gtgcttgctctgccagcttctatcccaaccatctgttgctttactatggccaaaaggaag atctctatccagcgactgcagagctacagaagaatcactggcagcaaatgtccccagaaa gctgtgatcttcagcaccaaacaggccaagaagatctgtgctgatccccagaagaagtgg gtccaggaagccatgaagtatttggaccaaaaatcccaaactttaaagccacaaatactc accttttga

DBGET integrated database retrieval system