KEGG   Camelus dromedarius (Arabian camel): 105088390
Entry
105088390         CDS       T04642                                 
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03050  Proteasome
cdk05010  Alzheimer disease
cdk05012  Parkinson disease
cdk05014  Amyotrophic lateral sclerosis
cdk05016  Huntington disease
cdk05017  Spinocerebellar ataxia
cdk05020  Prion disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    105088390 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    105088390 (PSMD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105088390 (PSMD7)
   05012 Parkinson disease
    105088390 (PSMD7)
   05014 Amyotrophic lateral sclerosis
    105088390 (PSMD7)
   05016 Huntington disease
    105088390 (PSMD7)
   05017 Spinocerebellar ataxia
    105088390 (PSMD7)
   05020 Prion disease
    105088390 (PSMD7)
   05022 Pathways of neurodegeneration - multiple diseases
    105088390 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:cdk03051]
    105088390 (PSMD7)
Proteasome [BR:cdk03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     105088390 (PSMD7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin Coilin_N
Other DBs
NCBI-GeneID: 105088390
NCBI-ProteinID: XP_010977509
LinkDB
Position
9:35370818..35379320
AA seq 324 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEDSKKDR
KDDKEKEKDKEKSDVKKEEKKEKK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaagtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaataggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtacttgatgtatccaacagttttgcagtcccttttgatgaa
gacgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatagttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccatcaatgaactcatgaaacgatactgccctaactcagta
ttggtcattatagacgtgaaaccaaaggacctgggactgcccacggaagcatatatttca
gtggaagaagttcatgatgatggaaccccaacctcaaaaacatttgagcatgtgaccagt
gaaattggagcagaggaagccgaggaagttggagtggaacacttgttacgagacatcaaa
gacactacagtgggcactctttcccagcggatcacaaaccaggtccatggtttgaaggga
ctcaactctaagcttctggatatcaggagctacctggagaaagtggccacgggcaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtcttcaacctgctgccagatgtc
agcctgcaggagtttgtcaaggccttctacctgaagaccaacgaccagatggtggttgtg
tatttggcctcactgatccgttccgtggtcgccttgcacaacctcatcaacaacaagatc
gccaaccgggatgcagagaagaaagaagggcaggaaaaagaagacagcaagaaagataga
aaagatgacaaagagaaagagaaagataaggaaaagagtgatgtaaagaaagaagagaaa
aaagagaaaaagtaa

DBGET integrated database retrieval system