Camelus dromedarius (Arabian camel): 105089160 Help Entry 105089160         CDS       T04642                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04613   Neutrophil extracellular trap formation cdk05034   Alcoholism cdk05203   Viral carcinogenesis cdk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cdk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105089160  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105089160   09163 Immune disease    05322 Systemic lupus erythematosus     105089160   09165 Substance dependence    05034 Alcoholism     105089160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     105089160   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cdk04147]     105089160 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105089160 Exosome [BR:cdk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105089160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  105089160 NCBI-ProteinID:  XP_010978469 UniProt:  A0A5N4CRF8 LinkDB All DBs Position 20:complement(25422004..25422504) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggcgaagtcagctccggccccgaagaagggctccaagaaagcggtgact aaagcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaagagagctactccgtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgcttcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system