Camelus dromedarius (Arabian camel): 105089162 Help Entry 105089162         CDS       T04642                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04613   Neutrophil extracellular trap formation cdk05034   Alcoholism cdk05203   Viral carcinogenesis cdk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cdk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105089162  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105089162   09163 Immune disease    05322 Systemic lupus erythematosus     105089162   09165 Substance dependence    05034 Alcoholism     105089162  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     105089162 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105089162 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  105089162 NCBI-ProteinID:  XP_031291361 LinkDB All DBs Position 20:25416773..25420798 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggtaaaggcggaaagggtcttggaaaaggaggcgctaagcgccaccgc aaggtgctgcgtgataacattcagggtattactaagcctgcgatccggcgtcttgctcgt cgtggtggtgtcaagcgtatctctggtctcatctacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgcgacgccgtcacctacaccgagcacgccaaacgcaag acggtcacggccatggacgtggtctacgcgctcaagcgtcagggacgcaccctctatggc ttcggaggctaa

DBGET integrated database retrieval system