Camelus dromedarius (Arabian camel): 105089494 Help Entry 105089494         CDS       T04642                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04015   Rap1 signaling pathway cdk04810   Regulation of actin cytoskeleton cdk05014   Amyotrophic lateral sclerosis cdk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105089494 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105089494 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105089494 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105089494 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cdk04131]     105089494 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cdk04812]     105089494 (PFN2)    04147 Exosome [BR:cdk04147]     105089494 (PFN2) Membrane trafficking [BR:cdk04131]  Others   Actin-binding proteins    Others     105089494 (PFN2) Cytoskeleton proteins [BR:cdk04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105089494 (PFN2) Exosome [BR:cdk04147]  Exosomal proteins   Proteins found in most exosomes    105089494 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105089494 NCBI-ProteinID:  XP_031305044 LinkDB All DBs Position 1:complement(25428453..25434492) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtg gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gttgccgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system