KEGG   Camelus dromedarius (Arabian camel): 105089720
Entry
105089720         CDS       T04642                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04610  Complement and coagulation cascades
cdk04810  Regulation of actin cytoskeleton
cdk05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105089720 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    105089720 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105089720 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cdk04515]
    105089720 (ITGAX)
   04090 CD molecules [BR:cdk04090]
    105089720 (ITGAX)
Cell adhesion molecules [BR:cdk04515]
 Integrins
  Integrin alpha subunits
   105089720 (ITGAX)
CD molecules [BR:cdk04090]
 Proteins
  105089720 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha DUF2785
Other DBs
NCBI-GeneID: 105089720
NCBI-ProteinID: XP_031288693
LinkDB
Position
18:complement(14747354..14770441)
AA seq 1207 aa
MHLSSQLPSRLRSRAISSRKPSWKSTPFQHSGSRIGLGAPKPMSDTPVMPKTGIFLLLLM
ALPSSLCFNLEMDKPTTFSMDSAGFGHSVVQYASWVVVGAPQEIKAANQTGGIYQCDYST
GMCKAIHLQVPPEAVNMSLGLSMAATTNPTQLLACGPTMHRACRENMHLTGFCFLLVSPS
WHAQRIPAALQECPKQEQDIAFLIDGSGSISFRDFAKMLNFVRAVMSHFQRPSSQFSLMQ
FSNKFVVHFTFKDFAISSDPLSLLNSVTQLRGYTHTATAIGMVTDQLFSASKGSRKDASK
ILIVITDGYKTGDYQDYKDVIPRAEAAGIIRYAIGVGSAFQTARSLQELQDIASKPSSEH
IFKVENFDALRDIQNQLKEKIFAIEGTQTTSSSSFELEMAQEGFSAVFTPDGPVLGAVGS
FSWSGGAFLYPPKMSPTFINMSQENGDMRDSYLGYSTELALWKGVQNLVLGAPRHQHTGK
VVLFTQVSRQWRPKAEVTGTQIGSYFGASLCSVDVDRDGSSDLVLIGAPHYYEQTRGGRV
SVCPLPKGWAKWQCGVILHGEQGHPWSRFGAALTVMGDVNGDKLMDVAIGAPGEQENHGA
IYLFHGTSGLSINPSYSQRIAGTQLSPRLQYFGQSLSGGQDLTQDGLVDLAVGARGHALL
LRTRPVLRVQATIRIFPAEIARSLFECQQHVASVQALGSATVCLHIHGSPKNRLGDLKSS
VTFDLTLDPGRLSPRAIFEETNTWNLTRVRVLGLTEHCEAVRLLLPACVEDSVTPIILRL
NFSLVGKHVSSFGNLQPVLAVDAQRYFTASLPFEKNCGANHVCEDDLSISFGVSGLKTLV
VGSNLELNLEVTVRNDGEDSYGTRVTFFYPPGLSYRRVAVGQNQLQSRALRLTCDSAPAR
SQDTISTRCSITHLIFREGAQITFMATFDVSPTAVLGDRLLLTANVSSENNTPRTSKTTF
QLEIPVKYAVYTVISSHEESTKYLNFSASEEKDSRGAQHRYQVNNLGQRDLPAIIDFSVP
VKLNRVAVWKDVEVFHPQNPFIQCSSERIVHRESDFLTHFWKNPVLDCSIADCLRFRCDI
PSFGVQEELDFILKGNLSFDWVSQTLQKKVVVVSVAEITFDRSVYSQLPGQEAFLRAQTE
LVLEKYEVHNPGPIIVGSTVGGLLLLALITAVLYKVGFFKRQYKEMMEEANGQTVPENGT
ADPQAAQ
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgcacctctctagtcagttgccttcaagactcagatcaagggccatctcctccaggaag
ccttcctggaaatctacacccttccaacatagcggctcccgcattggcttgggtgctccg
aagcctatgtctgacactccagtcatgcccaagaccgggatcttcctcctcctgctgatg
gccttgccttcctctctctgcttcaacttggaaatggacaagccgaccaccttcagcatg
gacagtgctgggtttggacacagcgtggtccagtacgccagctgggtggtggttggggcc
ccccaggagataaaggctgccaaccaaacaggtggcatctaccaatgtgactacagcaca
gggatgtgtaaggccatccacctgcaggtgcccccagaggctgtgaacatgtccctgggc
ttgtccatggcggccaccaccaaccccactcagctgctggcctgtggccccaccatgcac
cgtgcatgcagggagaacatgcacctgacggggttctgcttcttgctagtctccccatcc
tggcatgcccagaggatccccgctgccctgcaggagtgcccaaagcaggagcaggacatc
gccttcctgattgacggctcaggcagcatctccttcagagattttgccaaaatgctgaac
ttcgtgagggctgtgatgagccacttccagagaccgagctcccagttctccctgatgcag
ttctccaacaagtttgtggtgcacttcactttcaaagactttgcaatcagctcagaccca
ctaagcctgctgaattctgtaacgcagctgcgagggtacactcacacggccacagccatc
ggaatggtcacagaccaattgtttagcgcctcaaaagggtcccgaaaagatgcctccaag
atcctgatcgtcatcaccgatgggtacaaaacaggggactaccaggattacaaggatgtc
attcccagggctgaggccgctggcatcatccgctatgcaattggggtgggatcggctttt
caaactgcacgttccttgcaagaattacaggacattgcatcaaagccgtccagtgaacat
atatttaaagtagagaattttgatgctttgagagacattcaaaaccaactgaaagagaag
atctttgccatcgagggtacacagaccacaagcagtagctccttcgaattggagatggcc
caggagggcttcagtgctgtgttcacgcctgatggaccagttctgggggctgtggggagc
ttcagctggtctggaggggccttcctgtacccccccaaaatgagccccaccttcatcaac
atgtcccaggagaacggggacatgagggactcttacctgggttactccactgagctggcc
ctttggaagggggtacagaacctggtcctgggggccccccgccatcagcacaccgggaag
gttgtcctcttcacccaggtgtccaggcagtggaggccgaaggctgaagtcacagggacc
cagatcggctcctacttcggggcctccctctgctccgtggacgtggacagagatggcagc
tccgacctggtcctcatcggggccccgcattactatgagcagacccgggggggccgggtg
tccgtgtgccccttgcccaaggggtgggctaagtggcagtgtggggtcattctccatggg
gagcaaggccacccctggagccgctttggggcagccctgacagtgatgggggatgtgaat
ggggacaagctgatggacgtggccatcggggccccaggagagcaggagaaccatggtgcc
atctacctgtttcatggaacctcaggactgagtatcaacccctcatacagccagaggatt
gcaggtacccagctctctcccaggcttcagtattttgggcagtcactgagcgggggtcag
gacctcacccaggatggactggtggacttggctgtgggggcccggggacatgcgctactg
ctcaggaccagacctgtgctcagggtgcaggcaaccattcgcatctttccggcagagatc
gccaggtctctgtttgagtgccagcagcacgtggcctctgtccaggctctgggtagtgcc
actgtctgccttcatattcacggaagtcccaagaacaggctgggtgacctcaaaagctct
gtgacctttgaccttaccctcgatcctggccgcttgagccctcgtgccattttcgaggag
acaaatacctggaatctgactcgtgttcgagtcctggggctgacagagcactgcgaggct
gtgaggctgctccttccggcttgtgtggaagactcagtgacccccatcatcttgcgtctc
aacttctccctggtgggcaagcacgtctcttcctttggaaacctccagcccgtgctggct
gtggatgcccagagatacttcacggcttctctccccttcgagaagaactgtggtgccaat
cacgtctgcgaggatgacctcagcatttcctttggggtctcgggcttgaagacgctggtg
gtggggagtaacctggagctgaacttggaagtgacagtgcggaatgatggcgaggactcc
tatggaaccagagtcaccttcttctacccgccagggctgtcttaccgacgtgtagcagtg
ggccagaaccagctgcagtcacgcgccctgcgcctgacctgtgacagcgcccctgccagg
agtcaggacaccatcagcacccgctgtagcatcacccacctcatcttccgtgagggcgcc
cagatcaccttcatggccacctttgatgtctcccccacggccgtgctgggagaccggctg
cttctgaccgccaatgtgagcagtgagaataacactcccaggacaagcaagaccaccttc
cagctggagatcccggtcaagtacgctgtctacaccgtgatcagcagccatgaagagtcc
accaagtacctcaacttctcggcctcagaggagaaggacagccgtggggcccagcacaga
taccaggtgaacaacctgggacagagggacctgcctgccattattgatttctcagtgcct
gtgaagctgaaccgggtggcagtgtggaaggatgtggaggtcttccacccccagaacccg
ttcattcagtgctcttcagagagaatagtgcacagagagtctgacttcctgacccacttt
tggaagaatcctgtgctggactgctccattgctgactgcctgaggttccgctgtgacatc
ccctcctttggtgtccaggaggaacttgacttcattttgaagggcaacctcagctttgac
tgggtcagccagacattgcagaagaaggtggtagtcgtgagtgtggctgaaatcacattt
gacagatctgtgtattcccagcttccaggacaggaggcatttttgagagcccagacggag
ctggtgctggagaagtatgaggtccacaaccctggtcccattattgtgggcagcactgtg
ggaggactgctgctgctagctctcatcacagccgtactgtacaaggttggcttcttcaaa
cgtcagtacaaggaaatgatggaggaagcaaatggacagactgtcccagaaaacgggaca
gcagacccccaagctgcccaataa

DBGET integrated database retrieval system