Camelus dromedarius (Arabian camel): 105090101 Help Entry 105090101         CDS       T04642                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04630   JAK-STAT signaling pathway cdk04640   Hematopoietic cell lineage cdk04657   IL-17 signaling pathway cdk04658   Th1 and Th2 cell differentiation cdk04660   T cell receptor signaling pathway cdk04664   Fc epsilon RI signaling pathway cdk04672   Intestinal immune network for IgA production cdk05200   Pathways in cancer cdk05310   Asthma cdk05320   Autoimmune thyroid disease cdk05321   Inflammatory bowel disease cdk05330   Allograft rejection Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105090101 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105090101 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105090101 (IL5)    04660 T cell receptor signaling pathway     105090101 (IL5)    04658 Th1 and Th2 cell differentiation     105090101 (IL5)    04657 IL-17 signaling pathway     105090101 (IL5)    04664 Fc epsilon RI signaling pathway     105090101 (IL5)    04672 Intestinal immune network for IgA production     105090101 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105090101 (IL5)   09163 Immune disease    05310 Asthma     105090101 (IL5)    05320 Autoimmune thyroid disease     105090101 (IL5)    05321 Inflammatory bowel disease     105090101 (IL5)    05330 Allograft rejection     105090101 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105090101 (IL5)    00536 Glycosaminoglycan binding proteins [BR:cdk00536]     105090101 (IL5) Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Interleukins    105090101 (IL5) Glycosaminoglycan binding proteins [BR:cdk00536]  Heparan sulfate / Heparin   Cytokines    105090101 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  105090101 NCBI-ProteinID:  XP_010979597 UniProt:  A0A5N4EDE6 LinkDB All DBs Position 3:complement(95179034..95181947) Genome browser AA seq 134 aa AA seqDB search MRLLLHLSLLGLGAAYVCVIAVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHTNH QLCIEEVFQGIDTLKNQTEQGDAVEKLFQNLSLIKEYIDLQKKKCGGERWQVKQFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagattgcttctgcatttgagtttgctaggtcttggagctgcctacgtttgtgtcatt gctgtagaaagtcccatgaatagactggtggcagagaccttgacactgctctccactcat cgaactctgctgataggcgatgggaacttgatgattcctactcctgaacatacaaatcac caactatgtattgaagaagtctttcagggaatagacacattgaagaatcaaactgaacaa ggggatgccgtggaaaagctattccaaaacttgtctttaattaaagaatatatagacctc caaaaaaaaaagtgtggaggagaaagatggcaagtaaaacagttcctagactacctgcaa gttttccttggcgtaataaacactgagtggacaacagaaagctga

DBGET integrated database retrieval system