Camelus dromedarius (Arabian camel): 105091359 Help Entry 105091359         CDS       T04642                                  Symbol PPBP Name (RefSeq) platelet basic protein   KO K10029   platelet basic protein Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105091359 (PPBP)    04061 Viral protein interaction with cytokine and cytokine receptor     105091359 (PPBP)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     105091359 (PPBP)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105091359 (PPBP) Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Chemokines    105091359 (PPBP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105091359 NCBI-ProteinID:  XP_010981151 UniProt:  A0A5N4EGG8 LinkDB All DBs Position 2:71803767..71805297 Genome browser AA seq 119 aa AA seqDB search MSRRPSAASYCASASPLPALQVLLLLSLLLTTLVPSTIGETKRGERLLYVELRCLCVKTT SGIHPSNIQSLEVTRAGPHCTKVEVIALLKNGKKICLDPEAPVIKKIVQKMLEDRGSAA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgagccgcagacccagcgccgcctcctactgtgccagcgccagcccacttcctgccctc caggtgttgctgctactgtcactgctcctgaccacgctggttccctccaccatcggagaa actaaacgtggggaaagattgctgtacgtggaacttcgctgcctgtgtgtgaagaccacc tctggcattcatcccagtaacatccaaagtctggaggtgaccagggcaggaccccactgc accaaagttgaagtgatagccctgctgaagaatgggaagaaaatctgcctggacccagaa gctcctgtaatcaagaaaatagtccagaaaatgctggaagatcgtgggtcagctgcttaa

DBGET integrated database retrieval system