Camelus dromedarius (Arabian camel): 105092140 Help Entry 105092140         CDS       T04642                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04024   cAMP signaling pathway cdk04062   Chemokine signaling pathway cdk04064   NF-kappa B signaling pathway cdk04210   Apoptosis cdk04380   Osteoclast differentiation cdk04620   Toll-like receptor signaling pathway cdk04621   NOD-like receptor signaling pathway cdk04622   RIG-I-like receptor signaling pathway cdk04623   Cytosolic DNA-sensing pathway cdk04625   C-type lectin receptor signaling pathway cdk04657   IL-17 signaling pathway cdk04658   Th1 and Th2 cell differentiation cdk04659   Th17 cell differentiation cdk04660   T cell receptor signaling pathway cdk04662   B cell receptor signaling pathway cdk04668   TNF signaling pathway cdk04722   Neurotrophin signaling pathway cdk04920   Adipocytokine signaling pathway cdk04926   Relaxin signaling pathway cdk04931   Insulin resistance cdk04936   Alcoholic liver disease cdk05132   Salmonella infection cdk05134   Legionellosis cdk05135   Yersinia infection cdk05140   Leishmaniasis cdk05142   Chagas disease cdk05145   Toxoplasmosis cdk05160   Hepatitis C cdk05161   Hepatitis B cdk05162   Measles cdk05163   Human cytomegalovirus infection cdk05164   Influenza A cdk05166   Human T-cell leukemia virus 1 infection cdk05167   Kaposi sarcoma-associated herpesvirus infection cdk05168   Herpes simplex virus 1 infection cdk05169   Epstein-Barr virus infection cdk05170   Human immunodeficiency virus 1 infection cdk05171   Coronavirus disease - COVID-19 cdk05200   Pathways in cancer cdk05203   Viral carcinogenesis cdk05208   Chemical carcinogenesis - reactive oxygen species cdk05215   Prostate cancer cdk05220   Chronic myeloid leukemia cdk05222   Small cell lung cancer cdk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cdk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105092140 (NFKBIA)    04668 TNF signaling pathway     105092140 (NFKBIA)    04024 cAMP signaling pathway     105092140 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105092140 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105092140 (NFKBIA)    04621 NOD-like receptor signaling pathway     105092140 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     105092140 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     105092140 (NFKBIA)    04625 C-type lectin receptor signaling pathway     105092140 (NFKBIA)    04660 T cell receptor signaling pathway     105092140 (NFKBIA)    04658 Th1 and Th2 cell differentiation     105092140 (NFKBIA)    04659 Th17 cell differentiation     105092140 (NFKBIA)    04657 IL-17 signaling pathway     105092140 (NFKBIA)    04662 B cell receptor signaling pathway     105092140 (NFKBIA)    04062 Chemokine signaling pathway     105092140 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105092140 (NFKBIA)    04926 Relaxin signaling pathway     105092140 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     105092140 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     105092140 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105092140 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     105092140 (NFKBIA)    05203 Viral carcinogenesis     105092140 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105092140 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     105092140 (NFKBIA)    05215 Prostate cancer     105092140 (NFKBIA)    05222 Small cell lung cancer     105092140 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105092140 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     105092140 (NFKBIA)    05161 Hepatitis B     105092140 (NFKBIA)    05160 Hepatitis C     105092140 (NFKBIA)    05171 Coronavirus disease - COVID-19     105092140 (NFKBIA)    05164 Influenza A     105092140 (NFKBIA)    05162 Measles     105092140 (NFKBIA)    05168 Herpes simplex virus 1 infection     105092140 (NFKBIA)    05163 Human cytomegalovirus infection     105092140 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     105092140 (NFKBIA)    05169 Epstein-Barr virus infection     105092140 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     105092140 (NFKBIA)    05135 Yersinia infection     105092140 (NFKBIA)    05134 Legionellosis     105092140 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105092140 (NFKBIA)    05140 Leishmaniasis     105092140 (NFKBIA)    05142 Chagas disease     105092140 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105092140 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105092140 (NFKBIA)    04931 Insulin resistance     105092140 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cdk03000]     105092140 (NFKBIA)    04131 Membrane trafficking [BR:cdk04131]     105092140 (NFKBIA) Transcription factors [BR:cdk03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     105092140 (NFKBIA) Membrane trafficking [BR:cdk04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105092140 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  105092140 NCBI-ProteinID:  XP_010982098 LinkDB All DBs Position 6:complement(42329427..42333083) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGHEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEVLLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTRQTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgccgagcccggccacgagtgggccatggagggccctcgggatgcgctc aagaaggagcggctgctggacgaccgccacgatagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgggagatccgcctcgagcctcaggaggcgccg cgcggcgccgaaccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtagtccgccaagtaaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggtacttctggaagctggctgcgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagacccgccagacccagcacctccactccattctgcaggccaccaac tacaatggccacacgtgtctgcacttagcctctatccacggctacctgggcatcgtggag ctgttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaacggccgaaccgcc ctccatcttgcagtggacctgcagaatccagacctggtgtcgctcttgttgaagtgtgga gctgatgtcaacagagtcacctaccagggctactccccataccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccaactgacactagagaaccttcagatgctg ccagagagcgaggatgaggagagctatgacacagagtcagagttcacagaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system