Camelus dromedarius (Arabian camel): 105093664 Help Entry 105093664         CDS       T04642                                  Symbol IL2 Name (RefSeq) interleukin 2 precursor   KO K05429   interleukin 2 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04151   PI3K-Akt signaling pathway cdk04625   C-type lectin receptor signaling pathway cdk04630   JAK-STAT signaling pathway cdk04658   Th1 and Th2 cell differentiation cdk04659   Th17 cell differentiation cdk04660   T cell receptor signaling pathway cdk04672   Intestinal immune network for IgA production cdk04940   Type I diabetes mellitus cdk05135   Yersinia infection cdk05142   Chagas disease cdk05162   Measles cdk05166   Human T-cell leukemia virus 1 infection cdk05171   Coronavirus disease - COVID-19 cdk05200   Pathways in cancer cdk05320   Autoimmune thyroid disease cdk05321   Inflammatory bowel disease cdk05330   Allograft rejection cdk05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105093664 (IL2)    04151 PI3K-Akt signaling pathway     105093664 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105093664 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     105093664 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105093664 (IL2)    04660 T cell receptor signaling pathway     105093664 (IL2)    04658 Th1 and Th2 cell differentiation     105093664 (IL2)    04659 Th17 cell differentiation     105093664 (IL2)    04672 Intestinal immune network for IgA production     105093664 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105093664 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105093664 (IL2)    05171 Coronavirus disease - COVID-19     105093664 (IL2)    05162 Measles     105093664 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     105093664 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     105093664 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     105093664 (IL2)    05321 Inflammatory bowel disease     105093664 (IL2)    05330 Allograft rejection     105093664 (IL2)    05332 Graft-versus-host disease     105093664 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105093664 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105093664 (IL2)    00536 Glycosaminoglycan binding proteins [BR:cdk00536]     105093664 (IL2) Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Interleukins    105093664 (IL2) Glycosaminoglycan binding proteins [BR:cdk00536]  Heparan sulfate / Heparin   Cytokines    105093664 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Baculo_PEP_C DUF7037 Motif Other DBs NCBI-GeneID:  105093664 NCBI-ProteinID:  NP_001290477 UniProt:  D7REK6 LinkDB All DBs Position 2:35319162..35323635 Genome browser AA seq 154 aa AA seqDB search MYKLQFLSCIALTLALVANSAPTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRML TFKFYMPKKATELKHLQCLMEELKPLEDVLNLAQSKNSHLTNIKDSMNNINLTVSELKGS ETGFTCEYDDETVTVVEFLNKWITFCQSIYSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaagctgcaattcttgtcttgcattgcactaactcttgcactcgtagcaaacagt gcacctactttgagctctacgaaggacacaaagaaacaactggagccactgttgctggat ttacagtttcttttgaaggaagttaataactatgagaacctcaaactctccaggatgctc acatttaaattttacatgcccaagaaggctacagaattgaaacaccttcagtgtctcatg gaagaactcaaacctttggaggatgtgttaaatttagctcaaagcaaaaactctcacctg acaaatatcaaggactcaatgaacaatatcaatttaacggtttcggaactgaagggatct gaaacaggattcacatgtgaatatgatgatgagacagtaactgttgtagaatttctgaac aaatggattaccttttgccaaagtatctactcaacactgacttga

DBGET integrated database retrieval system