Camelus dromedarius (Arabian camel): 105093769 Help Entry 105093769         CDS       T04642                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04022   cGMP-PKG signaling pathway cdk04270   Vascular smooth muscle contraction cdk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     105093769 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     105093769 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105093769 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105093769 (NPPC) Cytokines and neuropeptides [BR:cdk04052]  Neuropeptides   Neuropeptides (Unclassified)    105093769 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  105093769 NCBI-ProteinID:  XP_010983977 LinkDB All DBs Position 5:complement(90104165..90108943) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLWPSEAKPGTPPKAPRTPPGEEVAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDVRVDTRSRAAWARILHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctctggccc tccgaagccaagcccgggacgccgccgaaggccccgcgaactccgccaggggaggaggtg gccgagccccaggctgcgggcggcggtcagaagaagggcgacaaaactcccgggggcggc ggcgccaatctcaagggcgaccggtcgcgactgctccgggacgtgcgcgtggacaccagg tctcgggcggcgtgggcccgcattctgcacgagcaccccaacgcgcgcaagtacaaagga ggcaacaagaagggtttgtccaagggctgctttggcctcaaactggaccggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system