Camelus dromedarius (Arabian camel): 105093823 Help Entry 105093823         CDS       T04642                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04062   Chemokine signaling pathway cdk04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105093823 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     105093823 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105093823 (CCL22)    04062 Chemokine signaling pathway     105093823 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105093823 (CCL22) Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Chemokines    105093823 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105093823 NCBI-ProteinID:  XP_010984048 LinkDB All DBs Position 9:complement(45003040..45072727) Genome browser AA seq 93 aa AA seqDB search MASLQTPLLAALILLAMILQATEAGPYAANVEDSICCRDYIRHPLPPRVVKYYYWTSDSC RRPGVVLLTVRDREICADPRLPWVKKILHRLDK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcagaccccactcctggctgccctcatcctccttgctatgatccttcaa gcaacagaggcaggcccctatgctgccaacgtggaggatagcatctgctgccgggactac atccgtcaccccctgcccccgcgtgtggtgaaatattactactggacttcggactcctgc cggaggcctggcgtggttttgctaaccgtgagggaccgagagatctgtgctgaccccaga ctcccctgggtgaagaagattctccacaggctggacaaatga

DBGET integrated database retrieval system