Camelus dromedarius (Arabian camel): 105094062 Help Entry 105094062         CDS       T04642                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04081   Hormone signaling cdk04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     105094062 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     105094062 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105094062 (GAST) Cytokines and neuropeptides [BR:cdk04052]  Neuropeptides   GPCR binding    105094062 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  105094062 NCBI-ProteinID:  XP_010984314 LinkDB All DBs Position 16:complement(23922517..23923049) Genome browser AA seq 104 aa AA seqDB search MQRLCAFALILVLALAASSEASWKPSSQLQEAPLAPGANRGQEQHGLDRLGPASHHRRQL GLEAPPHLVADLSKKQGPWLEEEEEAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcgtttgccctgatcttggtgctggctctggctgcctcctccgaa gcttcttggaagcccagctcccagttgcaggaggcacctttggctccaggggccaataga ggccaggagcagcatgggctggaccgactgggcccagcctctcaccaccgaaggcagctg gggcttgaggctcccccacatctggtggcagacctgtctaagaagcaggggccatggctg gaggaagaagaagaagcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacatccttag

DBGET integrated database retrieval system