Camelus dromedarius (Arabian camel): 105094142 Help Entry 105094142         CDS       T04642                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04613   Neutrophil extracellular trap formation cdk05034   Alcoholism cdk05202   Transcriptional misregulation in cancer cdk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cdk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105094142  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105094142   09163 Immune disease    05322 Systemic lupus erythematosus     105094142   09165 Substance dependence    05034 Alcoholism     105094142  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     105094142   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cdk04147]     105094142 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105094142 Exosome [BR:cdk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105094142 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF Motif Other DBs NCBI-GeneID:  105094142 NCBI-ProteinID:  XP_031305362 LinkDB All DBs Position 3:complement(120053535..120062190) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKRLDAKVARKSAPATCGMKRPHRFRPGTVTLREIRRFQKSTE LLIRKLPFQRLVREITQDFIADLRLQTSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDMRLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtctacaggcggcaaggcaccacgcaagcgg ttggacgctaaggtggctcgtaagagcgcacctgctacctgtggcatgaaaaggcctcac cggtttcggcccggcactgtaacgctgcgcgagatccgccgcttccagaagtccacggag ctgctcatccgcaagctgccgttccagcggctggtgcgggagattacccaggacttcata gcggatctgcgtcttcagacctcagctgtgatggcgctgcaggaagcgtgtgaggcctat ctggttggtctttttgaagacaccaatttgtgtgccatccacgccaagcgtgtaactatc atgcctaaagacatgcggttggcaaggcgtatccgtggcgagcgtgcttaa

DBGET integrated database retrieval system