Camelus dromedarius (Arabian camel): 105097868 Help Entry 105097868         CDS       T04642                                  Symbol CCL16 Name (RefSeq) C-C motif chemokine 16   KO K21093   C-C motif chemokine 16 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105097868 (CCL16)    04061 Viral protein interaction with cytokine and cytokine receptor     105097868 (CCL16)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     105097868 (CCL16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105097868 (CCL16) Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Chemokines    105097868 (CCL16) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105097868 NCBI-ProteinID:  XP_010988806 LinkDB All DBs Position 16:complement(12020366..12024126) Genome browser AA seq 101 aa AA seqDB search MKFSVAALFLLILIFTTSAVHSQPKVPDGVNLPPTCCVKYHEKVLPRKLVVGYKKALSCH LPAIIFVTKKNRQICANPNLKWVQDYIADPTVPLQPSRRSA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagttctccgtggctgccctcttcctcctcatcctcatcttcactacttctgctgtt cacagccagccaaaggttcctgacggggtgaaccttccacccacctgctgcgtgaagtat cacgagaaagtactgccaaggaaactggtggtgggatacaaaaaggccctcagttgtcac ctgccagcaatcatcttcgtcaccaaaaagaaccgacagatctgcgccaaccccaacctc aagtgggtccaagactacatcgcggatcccaccgtacctttgcagccctcccggaggtcg gcctag

DBGET integrated database retrieval system