Camelus dromedarius (Arabian camel): 105097869 Help Entry 105097869         CDS       T04642                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04062   Chemokine signaling pathway cdk04620   Toll-like receptor signaling pathway cdk04621   NOD-like receptor signaling pathway cdk04623   Cytosolic DNA-sensing pathway cdk04668   TNF signaling pathway cdk05020   Prion disease cdk05142   Chagas disease cdk05163   Human cytomegalovirus infection cdk05164   Influenza A cdk05168   Herpes simplex virus 1 infection cdk05323   Rheumatoid arthritis cdk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     105097869 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105097869 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     105097869 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105097869 (CCL5)    04621 NOD-like receptor signaling pathway     105097869 (CCL5)    04623 Cytosolic DNA-sensing pathway     105097869 (CCL5)    04062 Chemokine signaling pathway     105097869 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     105097869 (CCL5)    05168 Herpes simplex virus 1 infection     105097869 (CCL5)    05163 Human cytomegalovirus infection     105097869 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     105097869 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     105097869 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     105097869 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105097869 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105097869 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:cdk00536]     105097869 (CCL5) Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Chemokines    105097869 (CCL5) Glycosaminoglycan binding proteins [BR:cdk00536]  Heparan sulfate / Heparin   Chemokines    105097869 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  105097869 NCBI-ProteinID:  XP_010988808 UniProt:  A0A5N4D4Y9 LinkDB All DBs Position 16:complement(11988938..11997924) Genome browser AA seq 91 aa AA seqDB search MKVSTAVLAIILTAATLCAPASASPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSMA AVVFITRKNRQVCANPEKKWVREYINSLELS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccaccgcggtcctcgccatcatcctcaccgctgccaccctctgcgcacct gcgtctgcctccccatatgcctcggacaccacaccctgctgctttgcctacatctcccgc ccgctgccccgcgcccacatccaggagtatttctacaccagcagcaagtgctccatggca gcagtcgtctttatcaccagaaagaaccgccaggtgtgcgccaacccagagaagaaatgg gtgcgggagtacatcaactctttggagttgagctag

DBGET integrated database retrieval system