Camelus dromedarius (Arabian camel): 105098679 Help Entry 105098679         CDS       T04642                                  Name (RefSeq) late histone H2B.L4   KO K11252   histone H2B Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04613   Neutrophil extracellular trap formation cdk05034   Alcoholism cdk05203   Viral carcinogenesis cdk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cdk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105098679  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105098679   09163 Immune disease    05322 Systemic lupus erythematosus     105098679   09165 Substance dependence    05034 Alcoholism     105098679  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     105098679   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cdk04147]     105098679 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105098679 Exosome [BR:cdk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105098679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF ARM_TT21 YscO-like TAF Motif Other DBs NCBI-GeneID:  105098679 NCBI-ProteinID:  XP_010989727 UniProt:  A0A5N4DZP4 LinkDB All DBs Position 7:complement(81402700..81407679) Genome browser AA seq 124 aa AA seqDB search MSAERVQQQQPQPGSRRGRSSGDKKPRKRSRRKETYSMYIYKVLKQVHPDLGISSKAMSI MNSFVNDVFEQLAGEAARLAQYSSRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKY TSSK NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgagcgctgagcgtgtgcagcagcagcagccgcagcctgggagccggaggggccgcagt tctggggacaagaagcccagaaagcgcagccggcgcaaagaaacctactcaatgtacatc tacaaggtgctgaagcaggtgcatcccgacctcggcatctcctccaaggccatgagcatc atgaactcgtttgtgaatgatgtgtttgagcagctggctggcgaggccgcccgactggcc cagtactcaagccgaaccacactcacgtcccgggaagtgcagacagctgtgcgtctgctg ctgcctggggagctggccaagcatgctgtgtctgagggcaccaaggctgtcaccaagtac accagctccaagtga

DBGET integrated database retrieval system