Camelus dromedarius (Arabian camel): 105099696 Help Entry 105099696         CDS       T04642                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04066   HIF-1 signaling pathway cdk04120   Ubiquitin mediated proteolysis cdk05170   Human immunodeficiency virus 1 infection cdk05200   Pathways in cancer cdk05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:cdk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105099696 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     105099696 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105099696 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     105099696 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105099696 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cdk04121]     105099696 (ELOB)    03400 DNA repair and recombination proteins [BR:cdk03400]     105099696 (ELOB) Ubiquitin system [BR:cdk04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      105099696 (ELOB)    Cul5 complex      105099696 (ELOB) DNA repair and recombination proteins [BR:cdk03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105099696 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  105099696 NCBI-ProteinID:  XP_031303569 LinkDB All DBs Position Unknown AA seq 174 aa AA seqDB search MAAGRSAGAPPLADYLKWQPRGGAAGRGACWGPARGLPERGGARLRRASRGRGSRRDGRV SHIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDSKTLGECGFTS QTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atggcggccggacgctcagcaggagcgcccccacttgccgattacttaaaatggcagccg cggggaggggccgccggccgcggggcatgctgggggccggcgcgcgggttgccggaacgg ggcggagcgcggctgcgccgggcgtcgagggggagaggcagccgccgcgatggacgtgtt tctcatatccggcgccacaaaaccaccatcttcactgacgccaaggagtcgagcaccgtg tttgagctgaagcgcatcgtcgagggcatcctcaagcggccgccggacgagcagcggctg tacaaggacgaccagcttttggacgacagcaagacattgggcgagtgtggcttcaccagc cagacggctcggccgcaggccccagccactgtggggctagccttccgggcagatgatgct tttgaggccctgcgcattgagcccttctctagcccccctgagctgccggacgtgatgaag ccacaggactcgggaagcagcgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system