Camelus dromedarius (Arabian camel): 105102212 Help Entry 105102212         CDS       T04642                                  Symbol CENPX Name (RefSeq) centromere protein X isoform X1   KO K15360   centromere protein X Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cdk00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     105102212 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cdk03400]     105102212 (CENPX) DNA repair and recombination proteins [BR:cdk03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      105102212 (CENPX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  105102212 NCBI-ProteinID:  XP_031325248 LinkDB All DBs Position 16:complement(54791536..54795380) Genome browser AA seq 79 aa AA seqDB search MEETGAGFRKELVSKLLHLHFKEDKTKVSGDALQLTAELLKIFVIEAAIRSVRQAQAEEL GCVDLDQLEKVLPQLLLDF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaggaaaccggcgcgggcttccggaaagaactagtgagcaagctgctgcacctgcac tttaaagaggacaagaccaaagtcagtggggacgcactgcagctcacggcggagctcctg aagatctttgtcatagaagcagccatccgcagcgtgcggcaggcccaggcggaggagctg ggctgcgtggacttggaccagctggagaaggtgctgcctcagctgcttctggacttctag

DBGET integrated database retrieval system