KEGG   Camelus dromedarius (Arabian camel): 105102769
Entry
105102769         CDS       T04642                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04114  Oocyte meiosis
cdk04140  Autophagy - animal
cdk04148  Efferocytosis
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04218  Cellular senescence
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04270  Vascular smooth muscle contraction
cdk04350  TGF-beta signaling pathway
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04371  Apelin signaling pathway
cdk04380  Osteoclast differentiation
cdk04510  Focal adhesion
cdk04517  IgSF CAM signaling
cdk04519  Cadherin signaling
cdk04520  Adherens junction
cdk04540  Gap junction
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04611  Platelet activation
cdk04613  Neutrophil extracellular trap formation
cdk04620  Toll-like receptor signaling pathway
cdk04621  NOD-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04657  IL-17 signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagosome formation
cdk04668  TNF signaling pathway
cdk04713  Circadian entrainment
cdk04720  Long-term potentiation
cdk04722  Neurotrophin signaling pathway
cdk04723  Retrograde endocannabinoid signaling
cdk04724  Glutamatergic synapse
cdk04725  Cholinergic synapse
cdk04726  Serotonergic synapse
cdk04730  Long-term depression
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04912  GnRH signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04929  GnRH secretion
cdk04930  Type II diabetes mellitus
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04960  Aldosterone-regulated sodium reabsorption
cdk05010  Alzheimer disease
cdk05020  Prion disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05034  Alcoholism
cdk05132  Salmonella infection
cdk05133  Pertussis
cdk05135  Yersinia infection
cdk05140  Leishmaniasis
cdk05142  Chagas disease
cdk05145  Toxoplasmosis
cdk05152  Tuberculosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05207  Chemical carcinogenesis - receptor activation
cdk05208  Chemical carcinogenesis - reactive oxygen species
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105102769 (MAPK3)
   04012 ErbB signaling pathway
    105102769 (MAPK3)
   04014 Ras signaling pathway
    105102769 (MAPK3)
   04015 Rap1 signaling pathway
    105102769 (MAPK3)
   04350 TGF-beta signaling pathway
    105102769 (MAPK3)
   04370 VEGF signaling pathway
    105102769 (MAPK3)
   04371 Apelin signaling pathway
    105102769 (MAPK3)
   04668 TNF signaling pathway
    105102769 (MAPK3)
   04066 HIF-1 signaling pathway
    105102769 (MAPK3)
   04068 FoxO signaling pathway
    105102769 (MAPK3)
   04072 Phospholipase D signaling pathway
    105102769 (MAPK3)
   04071 Sphingolipid signaling pathway
    105102769 (MAPK3)
   04024 cAMP signaling pathway
    105102769 (MAPK3)
   04022 cGMP-PKG signaling pathway
    105102769 (MAPK3)
   04151 PI3K-Akt signaling pathway
    105102769 (MAPK3)
   04150 mTOR signaling pathway
    105102769 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    105102769 (MAPK3)
   04519 Cadherin signaling
    105102769 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105102769 (MAPK3)
   04148 Efferocytosis
    105102769 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105102769 (MAPK3)
   04210 Apoptosis
    105102769 (MAPK3)
   04218 Cellular senescence
    105102769 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105102769 (MAPK3)
   04520 Adherens junction
    105102769 (MAPK3)
   04540 Gap junction
    105102769 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    105102769 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105102769 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105102769 (MAPK3)
   04613 Neutrophil extracellular trap formation
    105102769 (MAPK3)
   04620 Toll-like receptor signaling pathway
    105102769 (MAPK3)
   04621 NOD-like receptor signaling pathway
    105102769 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    105102769 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    105102769 (MAPK3)
   04660 T cell receptor signaling pathway
    105102769 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    105102769 (MAPK3)
   04659 Th17 cell differentiation
    105102769 (MAPK3)
   04657 IL-17 signaling pathway
    105102769 (MAPK3)
   04662 B cell receptor signaling pathway
    105102769 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    105102769 (MAPK3)
   04666 Fc gamma R-mediated phagosome formation
    105102769 (MAPK3)
   04062 Chemokine signaling pathway
    105102769 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105102769 (MAPK3)
   04929 GnRH secretion
    105102769 (MAPK3)
   04912 GnRH signaling pathway
    105102769 (MAPK3)
   04915 Estrogen signaling pathway
    105102769 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    105102769 (MAPK3)
   04917 Prolactin signaling pathway
    105102769 (MAPK3)
   04921 Oxytocin signaling pathway
    105102769 (MAPK3)
   04926 Relaxin signaling pathway
    105102769 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    105102769 (MAPK3)
   04919 Thyroid hormone signaling pathway
    105102769 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    105102769 (MAPK3)
   04916 Melanogenesis
    105102769 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105102769 (MAPK3)
   04270 Vascular smooth muscle contraction
    105102769 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105102769 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    105102769 (MAPK3)
   04725 Cholinergic synapse
    105102769 (MAPK3)
   04726 Serotonergic synapse
    105102769 (MAPK3)
   04720 Long-term potentiation
    105102769 (MAPK3)
   04730 Long-term depression
    105102769 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    105102769 (MAPK3)
   04722 Neurotrophin signaling pathway
    105102769 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    105102769 (MAPK3)
   04380 Osteoclast differentiation
    105102769 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105102769 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105102769 (MAPK3)
   05206 MicroRNAs in cancer
    105102769 (MAPK3)
   05205 Proteoglycans in cancer
    105102769 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    105102769 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    105102769 (MAPK3)
   05203 Viral carcinogenesis
    105102769 (MAPK3)
   05230 Central carbon metabolism in cancer
    105102769 (MAPK3)
   05231 Choline metabolism in cancer
    105102769 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105102769 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105102769 (MAPK3)
   05212 Pancreatic cancer
    105102769 (MAPK3)
   05225 Hepatocellular carcinoma
    105102769 (MAPK3)
   05226 Gastric cancer
    105102769 (MAPK3)
   05214 Glioma
    105102769 (MAPK3)
   05216 Thyroid cancer
    105102769 (MAPK3)
   05221 Acute myeloid leukemia
    105102769 (MAPK3)
   05220 Chronic myeloid leukemia
    105102769 (MAPK3)
   05218 Melanoma
    105102769 (MAPK3)
   05211 Renal cell carcinoma
    105102769 (MAPK3)
   05219 Bladder cancer
    105102769 (MAPK3)
   05215 Prostate cancer
    105102769 (MAPK3)
   05213 Endometrial cancer
    105102769 (MAPK3)
   05224 Breast cancer
    105102769 (MAPK3)
   05223 Non-small cell lung cancer
    105102769 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105102769 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    105102769 (MAPK3)
   05161 Hepatitis B
    105102769 (MAPK3)
   05160 Hepatitis C
    105102769 (MAPK3)
   05171 Coronavirus disease
    105102769 (MAPK3)
   05164 Influenza A
    105102769 (MAPK3)
   05163 Human cytomegalovirus infection
    105102769 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105102769 (MAPK3)
   05165 Human papillomavirus infection
    105102769 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105102769 (MAPK3)
   05135 Yersinia infection
    105102769 (MAPK3)
   05133 Pertussis
    105102769 (MAPK3)
   05152 Tuberculosis
    105102769 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105102769 (MAPK3)
   05140 Leishmaniasis
    105102769 (MAPK3)
   05142 Chagas disease
    105102769 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105102769 (MAPK3)
   05020 Prion disease
    105102769 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    105102769 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    105102769 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105102769 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105102769 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105102769 (MAPK3)
   04934 Cushing syndrome
    105102769 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105102769 (MAPK3)
   01524 Platinum drug resistance
    105102769 (MAPK3)
   01522 Endocrine resistance
    105102769 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105102769 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105102769 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105102769 (MAPK3)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105102769 (MAPK3)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105102769 (MAPK3)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105102769 (MAPK3)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105102769 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 105102769
NCBI-ProteinID: XP_031327035
LinkDB
Position
18
AA seq 423 aa
MGSFSIGPSLAQGGQTPEGWAGGKGRGLGRGCRGEAGGREGRSGDGGGDGSGGGGGEPQG
ADGVRPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPF
EHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQ
QLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHD
HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNH
ILGILGSPSQEDLNCIINMKARNYLQSLPTKTKVAWTKLFPKSDPKALDLLDRMLTFNPN
KRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGVL
EGP
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgggatcatttagcattgggccgagcctggctcagggaggccaaactccagagggctgg
gcgggcgggaaggggcggggcctcgggcggggctgccggggggaggcgggcgggcgggag
gggaggagtggagatggcggcggcgacggctcagggggcgggggcggggagccccaggga
gctgatggggtgcggccgggggtcccgggggaagtggagatagtgaagggtcagccgttc
gacgtgggcccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtc
agctcagcttacgaccacgtgcgcaagactcgagtggccatcaagaaaatcagccccttt
gagcatcagacctactgccagcgtaccttgcgggagatccagatcttgctgcgcttccgc
catgagaacgtcattggcatccgagacattctgcgggcacccaccctggaagccatgagg
gatgtctacattgtgcaggacctgatggagacagacctgtacaagttgctcaaaagccag
cagctgagcaatgaccacgtctgctacttcctctaccagatcctgcgaggcctcaagtat
atccattcagccaacgtgctccaccgggacttaaagccctccaacctgctcatcaacacc
acctgcgaccttaagatctgtgattttggccttgcccggatcgctgatcctgagcacgac
cacactggcttcctgacggaatacgtggccacacgctggtaccgggccccagagatcatg
cttaactccaagggctacaccaagtccatcgatatctggtctgtgggctgcattctggct
gagatgctctccaaccggcccatcttccctggcaagcactacctggaccagctgaaccac
attctgggtatcctgggctccccatcccaggaggacctgaattgtatcatcaacatgaag
gcccgaaactacctacagtctctgcccaccaagaccaaggtggcctggaccaagcttttc
cccaagtcggaccccaaagctcttgacctgctggaccgcatgttgacctttaaccccaac
aaacggatcacagtggaagaagctctggctcacccctacctggagcagtactacgaccca
acagatgagccagtggccgaggaacctttcaccttcgacatggagctggatgatctaccc
aaggagcggctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctg
gagggcccctaa

DBGET integrated database retrieval system