Camelus dromedarius (Arabian camel): 105102874 Help Entry 105102874         CDS       T04642                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04080   Neuroactive ligand-receptor interaction cdk04081   Hormone signaling Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105102874 (PRLH)    04081 Hormone signaling     105102874 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105102874 (PRLH) Cytokines and neuropeptides [BR:cdk04052]  Neuropeptides   GPCR binding    105102874 (PRLH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prolactin_RP Motif Other DBs NCBI-GeneID:  105102874 NCBI-ProteinID:  XP_010994639 LinkDB All DBs Position 5:94408699..94411772 Genome browser AA seq 87 aa AA seqDB search MKALRAWLLCLLLLGLALRGAASRAHQHSMEIHTPDINPAWYTGRRIRPVGRFGRRRAAL RDVLKPGLLCLPACFSLEGGAEPAQGG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaggcgttgcgggcctggctcctgtgcctgctgctgctgggcctggccctgcggggg gcggccagccgcgcccaccagcactccatggagatccacacccctgacatcaacccggcc tggtacacgggccgcagaatccggcccgtgggccgcttcggccgcagaagagcagccctg agggatgtcctgaagcctggcctcctgtgcctgccagcctgcttctccctggagggaggt gctgagcccgcccagggtggctga

DBGET integrated database retrieval system