Camelus dromedarius (Arabian camel): 105105541 Help Entry 105105541         CDS       T04642                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04151   PI3K-Akt signaling pathway cdk04217   Necroptosis cdk04620   Toll-like receptor signaling pathway cdk04621   NOD-like receptor signaling pathway cdk04622   RIG-I-like receptor signaling pathway cdk04623   Cytosolic DNA-sensing pathway cdk04630   JAK-STAT signaling pathway cdk04650   Natural killer cell mediated cytotoxicity cdk04936   Alcoholic liver disease cdk05152   Tuberculosis cdk05160   Hepatitis C cdk05161   Hepatitis B cdk05162   Measles cdk05163   Human cytomegalovirus infection cdk05164   Influenza A cdk05165   Human papillomavirus infection cdk05167   Kaposi sarcoma-associated herpesvirus infection cdk05168   Herpes simplex virus 1 infection cdk05169   Epstein-Barr virus infection cdk05170   Human immunodeficiency virus 1 infection cdk05171   Coronavirus disease - COVID-19 cdk05200   Pathways in cancer cdk05320   Autoimmune thyroid disease cdk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105105541    04151 PI3K-Akt signaling pathway     105105541   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105105541  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105105541  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105105541    04621 NOD-like receptor signaling pathway     105105541    04622 RIG-I-like receptor signaling pathway     105105541    04623 Cytosolic DNA-sensing pathway     105105541    04650 Natural killer cell mediated cytotoxicity     105105541  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105105541   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105105541    05161 Hepatitis B     105105541    05160 Hepatitis C     105105541    05171 Coronavirus disease - COVID-19     105105541    05164 Influenza A     105105541    05162 Measles     105105541    05168 Herpes simplex virus 1 infection     105105541    05163 Human cytomegalovirus infection     105105541    05167 Kaposi sarcoma-associated herpesvirus infection     105105541    05169 Epstein-Barr virus infection     105105541    05165 Human papillomavirus infection     105105541   09171 Infectious disease: bacterial    05152 Tuberculosis     105105541   09163 Immune disease    05320 Autoimmune thyroid disease     105105541   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105105541   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105105541  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105105541 Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Interferons    105105541 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  105105541 NCBI-ProteinID:  XP_010997642 LinkDB All DBs Position 4:6286690..6287444 Genome browser AA seq 187 aa AA seqDB search MSPVARPLSLLMALVALSFDSICSLGCDLPQIHSLATRRTLVLLGQMRRISPSSCLKDRQ DFGFPQEVLGGHRLQKAQAISVFHELVQQLFLLFSTEGSSAAWEDSLLHRLCTGLDQQLT ELEACPKQEAELQGRLLLNEDPILAVRRYFHRITLYLQEKKYSPCAWEIVRAEVMRSFSS ARHLQER NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgtccccagtggctcgacccttgtccttactcatggccctggtggcgctcagcttcgac tccatctgctctctgggctgtgacctgcctcagatccacagcctggccaccaggaggacc ttggtgctcctgggacaaatgaggagaatctccccctcctcctgcctgaaggacagacag gactttggattccctcaggaggtccttggtggccaccggctccagaaggctcaagccatc tctgtcttccatgagctggtccagcagctcttcctcctcttcagcacagagggctcgtct gctgcctgggaggacagcctcctgcacagactctgcactgggcttgatcagcagctgacg gagctggaagcctgtccgaagcaggaggcggagctgcaagggcgtctcctgctgaatgag gaccccatcctggctgtgaggagatacttccacagaatcactctctatctgcaagagaag aaatacagcccttgtgcctgggagatcgtcagagcagaagtcatgagatccttctcttca gcgagacacttgcaagaaagatga

DBGET integrated database retrieval system