Camelus dromedarius (Arabian camel): 105105543 Help Entry 105105543         CDS       T04642                                  Name (RefSeq) interferon tau-like   KO K05440   interferon omega Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04622   RIG-I-like receptor signaling pathway cdk04630   JAK-STAT signaling pathway Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105105543   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105105543  09150 Organismal Systems   09151 Immune system    04622 RIG-I-like receptor signaling pathway     105105543  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105105543 Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Interferons    105105543 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon LXG Motif Other DBs NCBI-GeneID:  105105543 NCBI-ProteinID:  XP_010997644 LinkDB All DBs Position 4:6281943..6282349 Genome browser AA seq 102 aa AA seqDB search MDGSQLRKAQAISVLHEMLQQILNLFPAERSSAACDTTLLDKLRTGLHQQLEDLDTSLVQ VMGEQDSAQGRAGPTLAVKSYFQGIHLYLKEKIYSDYAWEIV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggatggcagccagctccggaaggcccaggccatctctgtcctccacgagatgctccag cagatcctcaacctcttccctgcagagcgctcctctgctgcctgcgacaccaccctcctg gacaaactccgcactggactccatcagcagctggaggacctggacacctctttggtgcag gtgatgggagagcaagactctgcccagggaagggcgggccctacactggccgtgaagagc tacttccagggaatccatctctacctgaaagagaagatatacagtgactatgcctgggaa attgtctga

DBGET integrated database retrieval system