Camelus dromedarius (Arabian camel): 105107014 Help Entry 105107014         CDS       T04642                                  Name (RefSeq) centromere protein S isoform X1   KO K11511   centromere protein S Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cdk00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     105107014  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     105107014    03400 DNA repair and recombination proteins [BR:cdk03400]     105107014 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      105107014 DNA repair and recombination proteins [BR:cdk03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      105107014 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Bromo_TP COMMD1_N DUF4087 Motif Other DBs NCBI-GeneID:  105107014 NCBI-ProteinID:  XP_010999119 UniProt:  A0A5N4DDP2 LinkDB All DBs Position 13:7424468..7434667 Genome browser AA seq 139 aa AA seqDB search MMEEKEGAEEQQRFSYRQRLKAAVHYTVGCLCEEVASDKEVQFSKQTIAAISEVTFRQCE NFARDLEMFARHAKRSTINTEDVKLLARRSNSLLKYITERNEDIAQFNLERKAKKKKKLE DENKNSVEPAEAGAVESED NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgatggaggagaaggagggggctgaggagcaacagcgattctcttaccgacagaggcta aaggcagcagttcactacaccgttggctgtctttgcgaggaagttgcatcggacaaagaa gtgcagttcagcaaacaaaccattgcggcgatttcggaggtgaccttccgacagtgcgaa aattttgccagagaccttgaaatgtttgcaagacatgcgaaaagaagcacaattaacact gaagatgtgaagctcttagccaggaggagtaattcactgctaaaatacatcacagagaga aatgaagacattgctcagtttaacctggaacgaaaagcaaagaagaaaaagaagctagag gatgaaaacaaaaattcagtggagccagcagaggctggtgcagtggaaagtgaggattaa

DBGET integrated database retrieval system