Camelus dromedarius (Arabian camel): 116147140 Help Entry 116147140         CDS       T04642                                  Name (RefSeq) tubulin alpha-1C chain-like   KO K07374   tubulin alpha Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04145   Phagosome cdk04210   Apoptosis cdk04517   IgSF CAM signaling cdk04530   Tight junction cdk04540   Gap junction cdk04814   Motor proteins cdk05010   Alzheimer disease cdk05012   Parkinson disease cdk05014   Amyotrophic lateral sclerosis cdk05016   Huntington disease cdk05020   Prion disease cdk05022   Pathways of neurodegeneration - multiple diseases cdk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     116147140  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     116147140   09143 Cell growth and death    04210 Apoptosis     116147140   09144 Cellular community - eukaryotes    04530 Tight junction     116147140    04540 Gap junction     116147140   09142 Cell motility    04814 Motor proteins     116147140  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116147140   09164 Neurodegenerative disease    05010 Alzheimer disease     116147140    05012 Parkinson disease     116147140    05014 Amyotrophic lateral sclerosis     116147140    05016 Huntington disease     116147140    05020 Prion disease     116147140    05022 Pathways of neurodegeneration - multiple diseases     116147140  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cdk03019]     116147140    03036 Chromosome and associated proteins [BR:cdk03036]     116147140   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cdk04812]     116147140    04147 Exosome [BR:cdk04147]     116147140 Messenger RNA biogenesis [BR:cdk03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      116147140 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      116147140 Cytoskeleton proteins [BR:cdk04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     116147140 Exosome [BR:cdk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116147140   Exosomal proteins of other body fluids (saliva and urine)    116147140   Exosomal proteins of colorectal cancer cells    116147140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tubulin Tubulin_3 Tubulin_C Motif Other DBs NCBI-GeneID:  116147140 NCBI-ProteinID:  XP_031302787 LinkDB All DBs Position Unknown AA seq 263 aa AA seqDB search YCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTY RQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGG GTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFM VDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYP RIHFPLATYAPVISAEKAYHEQL NT seq 791 nt NT seq  +upstreamnt  +downstreamnt tctactgcctggaacatggcatccagcccgatggccagatgccaagtgacaagaccattg ggggaggagacgactccttcaacaccttcttcagtgagacaggcgctggcaagcatgtgc ccagggcagtgttcgtagacctggaacctacagtcattgatgaagttcgcactggcacct accgccagctcttccaccctgagcagctcatcacaggcaaagaagatgctgccaataact atgcccgcggtcactacaccattggcaaggagatcattgacctcgtcttggaccgaattc ggaaactggctgaccagtgcacaggtcttcagggcttcttggttttccacagcttcggcg ggggaactggttctgggtttacctccctgctgatggaacgtctctctgtcgattatggca agaagtctaagctggagttctccatttatccagccccccaggtttccacagctgtagttg agccctacaactccatcctcaccacccacaccaccctggagcactctgattgtgccttca tggtagacaacgaggccatctatgacatctgtcgtagaaacctcgatattgagcgcccaa cctacactaatcttaaccgccttattagccagattgtgtcctccatcactgcttccctga ggtttgatggagccctgaatgtcgatctgacagaattccagaccaacctggtgccctatc ctcgcatccacttccctctggccacatatgcccctgtcatctctgctgagaaagcctacc atgaacagctt

DBGET integrated database retrieval system