Camelus dromedarius (Arabian camel): 116147777 Help Entry 116147777         CDS       T04642                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04613   Neutrophil extracellular trap formation cdk05034   Alcoholism cdk05202   Transcriptional misregulation in cancer cdk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cdk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116147777  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     116147777   09163 Immune disease    05322 Systemic lupus erythematosus     116147777   09165 Substance dependence    05034 Alcoholism     116147777  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     116147777   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cdk04147]     116147777 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116147777 Exosome [BR:cdk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116147777 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF CENP-S CENP-T_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  116147777 NCBI-ProteinID:  XP_031291345 LinkDB All DBs Position 20:complement(25367681..25369248) Genome browser AA seq 135 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQALVREIAQDSDRPASRARPWMALQEACEAYLVGLFEDTNLCAIHAKRVTIM PKDIQLARRIRGERA NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggctcgcaccaagcaaacagcccgcaagtccaccggcggcaaagcgccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgccgttccaagcgctggtgcgcgagatcgcgcaggattcagac cgacctgcctccagagctcggccgtggatggcgctgcaggaggcgtgcgaggcctacctg gtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatcatg cccaaggacatccagcttgcccgccgcatccgcggggagagggcataa

DBGET integrated database retrieval system