Camelus dromedarius (Arabian camel): 116147789 Help Entry 116147789         CDS       T04642                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04613   Neutrophil extracellular trap formation cdk05034   Alcoholism cdk05203   Viral carcinogenesis cdk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cdk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116147789  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     116147789   09163 Immune disease    05322 Systemic lupus erythematosus     116147789   09165 Substance dependence    05034 Alcoholism     116147789  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     116147789 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116147789 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  116147789 NCBI-ProteinID:  XP_031291364 LinkDB All DBs Position 20:25363853..25364350 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagaggtaagggtggaaagggcctgggaaaaggaggtgccaagcgccaccgc aaagttctgcgtgacaacatccagggcatcactaagcccgcgatccggcgtcttgctcgt cgtggtggtgtcaagcgtatctcaggtctcatctacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgcgacgccgtcacctacaccgagcacgccaagcgcaag acggtcacggccatggacgtagtctatgctctcaaacgccagggccgcaccctctacggc ttcggtggctaa

DBGET integrated database retrieval system