Camelus dromedarius (Arabian camel): 116151371 Help Entry 116151371         CDS       T04642                                  Name (RefSeq) tubulin beta chain-like   KO K07375   tubulin beta Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04145   Phagosome cdk04540   Gap junction cdk04814   Motor proteins cdk05010   Alzheimer disease cdk05012   Parkinson disease cdk05014   Amyotrophic lateral sclerosis cdk05016   Huntington disease cdk05020   Prion disease cdk05022   Pathways of neurodegeneration - multiple diseases cdk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cdk00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     116151371   09144 Cellular community - eukaryotes    04540 Gap junction     116151371   09142 Cell motility    04814 Motor proteins     116151371  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116151371   09164 Neurodegenerative disease    05010 Alzheimer disease     116151371    05012 Parkinson disease     116151371    05014 Amyotrophic lateral sclerosis     116151371    05016 Huntington disease     116151371    05020 Prion disease     116151371    05022 Pathways of neurodegeneration - multiple diseases     116151371  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cdk03036]     116151371   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cdk04812]     116151371    04147 Exosome [BR:cdk04147]     116151371 Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      116151371 Cytoskeleton proteins [BR:cdk04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     116151371 Exosome [BR:cdk04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    116151371   Exosomal proteins of colorectal cancer cells    116151371   Exosomal proteins of bladder cancer cells    116151371 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tubulin Tubulin_C Tubulin_3 Tubulin_2 Motif Other DBs NCBI-GeneID:  116151371 NCBI-ProteinID:  XP_031302642 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search GQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLI SKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICF RTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAP LTSRGSQQYRA NT seq 573 nt NT seq  +upstreamnt  +downstreamnt ggccagagtggtgccgggaacaactgggccaagggccactacacggagggcgccgagctg gtggactcggtcctggacgtggtgaggaaggagtccgagagctgtgactgtctgcagggc ttccagctgacccactcgctggggggcggcacgggctctgggatggggaccctcctcatc agcaagatccgggaggagtaccccgaccgcatcatgaacaccttcagcgtgatgccctcg cccaaggtgtcggacaccgtggtcgagccctacaacgccaccctctccgtgcaccagctg gtggagaacacggacgagacctactccatcgacaacgaggcgctgtacgacatctgcttc cgcaccctcaaactgaccacgcccacctacggggacctcaaccacctggtgtcggccacc atgagcggcgtcaccacctgcctgcgcttcccgggccagctcaacgccgacctgcgcaag ctggccgtgaacatggtgcccttcccgcgcctgcatttcttcatgcccggcttcgcgccg ctcaccagccggggcagccagcagtaccgcgcg

DBGET integrated database retrieval system