Camelus dromedarius (Arabian camel): 116152603 Help Entry 116152603         CDS       T04642                                  Name (RefSeq) interferon alpha-14-like Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04151   PI3K-Akt signaling pathway cdk04217   Necroptosis cdk04620   Toll-like receptor signaling pathway cdk04621   NOD-like receptor signaling pathway cdk04622   RIG-I-like receptor signaling pathway cdk04623   Cytosolic DNA-sensing pathway cdk04630   JAK-STAT signaling pathway cdk04650   Natural killer cell mediated cytotoxicity cdk04936   Alcoholic liver disease cdk05152   Tuberculosis cdk05160   Hepatitis C cdk05161   Hepatitis B cdk05162   Measles cdk05164   Influenza A cdk05165   Human papillomavirus infection cdk05167   Kaposi sarcoma-associated herpesvirus infection cdk05171   Coronavirus disease - COVID-19 cdk05200   Pathways in cancer cdk05320   Autoimmune thyroid disease cdk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116152603    04151 PI3K-Akt signaling pathway     116152603   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116152603  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116152603  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116152603    04621 NOD-like receptor signaling pathway     116152603    04622 RIG-I-like receptor signaling pathway     116152603    04623 Cytosolic DNA-sensing pathway     116152603    04650 Natural killer cell mediated cytotoxicity     116152603  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116152603   09172 Infectious disease: viral    05161 Hepatitis B     116152603    05160 Hepatitis C     116152603    05171 Coronavirus disease - COVID-19     116152603    05164 Influenza A     116152603    05162 Measles     116152603    05167 Kaposi sarcoma-associated herpesvirus infection     116152603    05165 Human papillomavirus infection     116152603   09171 Infectious disease: bacterial    05152 Tuberculosis     116152603   09163 Immune disease    05320 Autoimmune thyroid disease     116152603   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116152603   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116152603 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon DUF4329 Motif Other DBs NCBI-GeneID:  116152603 NCBI-ProteinID:  XP_031305485 LinkDB All DBs Position 4:6647268..6649595 Genome browser AA seq 177 aa AA seqDB search MAQICVLVAGVMLCSLPACSLARNLPEIQSLENKEIVRLLRHMKRTPLHSCLKDRRDFKL PWERDNIAQNQTAQGPCSYHQMLQQIFHLFSTEHSHAAWDNTSLNKLLSSLDLTLHQLEQ AEEGNLDCPFWGTAVREYFQAIHLYLKEKEYSPCAWEIVREETKKRLSFMKHPKWKA NT seq 534 nt NT seq  +upstreamnt  +downstreamnt atggcccagatctgcgtgcttgtggcaggagtgatgctctgctccctccctgcttgctct cttgccaggaacttgcctgagatccagagcctagaaaacaaggagatcgtcaggcttttg agacacatgaaacggaccccccttcactcatgcctaaaggacaggagggacttcaaactt ccctgggaaagagacaatatcgcccaaaaccagacggctcaaggcccctgttcctaccat cagatgctccagcagattttccacctcttcagcacagagcacagccatgctgcttgggac aacacctccctaaataaactactctccagtctggatctcaccctgcaccaactggagcag gctgaagaaggcaatctagactgtcccttttggggaactgctgttcgggagtatttccaa gcaattcatctctacttgaaggaaaaggaatacagcccctgtgcctgggagattgtcaga gaggaaactaaaaagcgcctttccttcatgaaacatccgaaatggaaagcatga

DBGET integrated database retrieval system