Camelus dromedarius (Arabian camel): 116157512 Help Entry 116157512         CDS       T04642                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04010   MAPK signaling pathway cdk04020   Calcium signaling pathway cdk04022   cGMP-PKG signaling pathway cdk04114   Oocyte meiosis cdk04218   Cellular senescence cdk04310   Wnt signaling pathway cdk04360   Axon guidance cdk04370   VEGF signaling pathway cdk04380   Osteoclast differentiation cdk04625   C-type lectin receptor signaling pathway cdk04650   Natural killer cell mediated cytotoxicity cdk04658   Th1 and Th2 cell differentiation cdk04659   Th17 cell differentiation cdk04660   T cell receptor signaling pathway cdk04662   B cell receptor signaling pathway cdk04720   Long-term potentiation cdk04724   Glutamatergic synapse cdk04921   Oxytocin signaling pathway cdk04922   Glucagon signaling pathway cdk04924   Renin secretion cdk05010   Alzheimer disease cdk05014   Amyotrophic lateral sclerosis cdk05020   Prion disease cdk05022   Pathways of neurodegeneration - multiple diseases cdk05031   Amphetamine addiction cdk05152   Tuberculosis cdk05163   Human cytomegalovirus infection cdk05166   Human T-cell leukemia virus 1 infection cdk05167   Kaposi sarcoma-associated herpesvirus infection cdk05170   Human immunodeficiency virus 1 infection cdk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cdk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116157512 (PPP3R1)    04310 Wnt signaling pathway     116157512 (PPP3R1)    04370 VEGF signaling pathway     116157512 (PPP3R1)    04020 Calcium signaling pathway     116157512 (PPP3R1)    04022 cGMP-PKG signaling pathway     116157512 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116157512 (PPP3R1)    04218 Cellular senescence     116157512 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116157512 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     116157512 (PPP3R1)    04660 T cell receptor signaling pathway     116157512 (PPP3R1)    04658 Th1 and Th2 cell differentiation     116157512 (PPP3R1)    04659 Th17 cell differentiation     116157512 (PPP3R1)    04662 B cell receptor signaling pathway     116157512 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     116157512 (PPP3R1)    04921 Oxytocin signaling pathway     116157512 (PPP3R1)    04924 Renin secretion     116157512 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     116157512 (PPP3R1)    04720 Long-term potentiation     116157512 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     116157512 (PPP3R1)    04380 Osteoclast differentiation     116157512 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116157512 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116157512 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     116157512 (PPP3R1)    05163 Human cytomegalovirus infection     116157512 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     116157512 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     116157512 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     116157512 (PPP3R1)    05014 Amyotrophic lateral sclerosis     116157512 (PPP3R1)    05020 Prion disease     116157512 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     116157512 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     116157512 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116157512 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cdk01009]     116157512 (PPP3R1) Protein phosphatases and associated proteins [BR:cdk01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116157512 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  116157512 NCBI-ProteinID:  XP_031323033 LinkDB All DBs Position 15:complement(50574103..50627189) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcgagttatcctttggaaatgtgctcacactttgacgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctgggtctttgagtgtg gaagagttcatgtctctgcctgaattacaacaaaatcccctagtacagcgagtaatagat atattcgacacagacgggaatggagaagtagactttaaagagttcattgagggagtctct caattcagtgtcaaaggagataaagaacagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaacctgaaagacacacagttacagcagatcgtagacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggcggccta gacatccacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system