Camelus dromedarius (Arabian camel): 5618955 Help Entry 5618955           CDS       T04642                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk00190   Oxidative phosphorylation cdk01100   Metabolic pathways cdk04714   Thermogenesis cdk04723   Retrograde endocannabinoid signaling cdk05010   Alzheimer disease cdk05012   Parkinson disease cdk05014   Amyotrophic lateral sclerosis cdk05016   Huntington disease cdk05020   Prion disease cdk05022   Pathways of neurodegeneration - multiple diseases cdk05208   Chemical carcinogenesis - reactive oxygen species cdk05415   Diabetic cardiomyopathy Module cdk_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:cdk00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     5618955 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     5618955 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     5618955 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     5618955 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     5618955 (ND4L)    05012 Parkinson disease     5618955 (ND4L)    05014 Amyotrophic lateral sclerosis     5618955 (ND4L)    05016 Huntington disease     5618955 (ND4L)    05020 Prion disease     5618955 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     5618955 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     5618955 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cdk03029]     5618955 (ND4L) Enzymes [BR:cdk01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      5618955 (ND4L) Mitochondrial biogenesis [BR:cdk03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     5618955 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  5618955 NCBI-ProteinID:  YP_001488950 UniProt:  A8DIQ0 LinkDB All DBs Position MT:9886..10182 Genome browser AA seq 98 aa AA seqDB search MSMVYMNIILAFTMSLAGLLMYRSHLMSSLLCLEGMMLSLFVMASLMILNNHFTLASVMP IILLVFAACEAALGLALLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtccatagtgtatataaatattatcctagcattcactatgtccctcgccggtctcctg atatatcgatcccacctaatatcttccctactatgcctagaaggcatgatgctttctctc tttgtaatggcgtccctaataatcctaaataaccactttaccttagccagcgtcatgcct attatcctcttagtattcgcagcgtgtgaggccgcattaggcctagccctactagtaata gtctctaacacatacggcacagactacgtacaaaacctcaacctcctacaatgttaa

DBGET integrated database retrieval system