Clostridioides difficile R20291: CDR20291_0114 Help Entry CDR20291_0114     CDS       T00998                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cdl  Clostridioides difficile R20291 Pathway cdl00020   Citrate cycle (TCA cycle) cdl00720   Other carbon fixation pathways cdl01100   Metabolic pathways cdl01110   Biosynthesis of secondary metabolites cdl01120   Microbial metabolism in diverse environments cdl01200   Carbon metabolism cdl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cdl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CDR20291_0114   09102 Energy metabolism    00720 Other carbon fixation pathways     CDR20291_0114 Enzymes [BR:cdl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CDR20291_0114 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_10 Fer4_6 Fer4_7 Fer4_21 Fer4_9 Fer4_15 Fer4_8 Fer4_16 Fer4_4 Fer4_22 Fer4_3 Fer4_17 Fer4_13 Fer4_18 Fer4_Nqo3 Motif Other DBs NCBI-ProteinID:  CBE01660 UniProt:  A0A9R0BHK6 LinkDB All DBs Position 154477..154692 Genome browser AA seq 71 aa AA seqDB search MAKGKVSFNQERCKGCGLCVEACPVKIIQLDSNVINKKGYNPATVFEMEKCIGCASCATM CPDVVITVERD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggaaaagtatcttttaatcaagaacgttgtaaaggttgtggattgtgtgtt gaagcatgtccagtaaaaatcatacaattagactcaaatgtaataaacaaaaaagggtat aacccagcaactgtttttgaaatggaaaaatgcataggatgtgcaagttgtgcaactatg tgtccagatgtagttataacagtagaaagagattaa

DBGET integrated database retrieval system