Cronobacter dublinensis: AFK67_19535 Help Entry AFK67_19535       CDS       T04061                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cdm  Cronobacter dublinensis Pathway cdm01100   Metabolic pathways cdm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cdm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFK67_19535    00074 Mycolic acid biosynthesis     AFK67_19535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFK67_19535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALB68552 LinkDB All DBs Position 4203711..4203968 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIINTLNLEELSADDIETDAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVASLASFIHSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatcttgaaattaaaaatctgattatcaacacgctcaacctcgaagaa ctgagcgccgatgatattgaaaccgacgccgccctgtttggcgacgggctgggtctcgat tctatcgacgcgcttgaactggggctggcagttaaaaaccaatacggcgttgtgctttcc gcagaaagcgaagagatgcgtcagcactttttctctgtcgcctcgctggcgtcttttatt cattcccaacgcgcataa

DBGET integrated database retrieval system