Castellaniella defragrans: BN940_05421 Help Entry BN940_05421       CDS       T03058                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism cdn  Castellaniella defragrans Pathway cdn01100   Metabolic pathways cdn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cdn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BN940_05421    00074 Mycolic acid biosynthesis     BN940_05421   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BN940_05421 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 Ribosomal_L50 HLH EutQ Motif Other DBs NCBI-ProteinID:  CDM23553 UniProt:  W8WV24 LinkDB All DBs Position 1165646..1165885 Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAVDYITSHSKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgagcaactcggcgtcaacgaa gccgagatcaagaacgaatcttccttccttgacgacctcggtgccgattcgctcgatatg gtcgagctcgtgatggccctcgaagacgaatttgaaaccgagattcccgacgaggaagcc gagaagatcacgacggtccagcaggcggtcgactacatcacctcgcacagcaagcaataa

DBGET integrated database retrieval system